SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296101619|ref|YP_003611765.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296101619|ref|YP_003611765.1|
Domain Number 1 Region: 96-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000432
Family NfeD domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|296101619|ref|YP_003611765.1|
Domain Number - Region: 31-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00523
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296101619|ref|YP_003611765.1|
Sequence length 150
Comment nodulation efficiency family protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MIELIVAHPHAFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLLVWLLPLDWAWQGALF
AVLTLVAAWLWWRWLNRQVNEQEPLDTHLNQRGQQIVGQRFTLETALVNGRGHMRVGDSS
WPVVADDDLSAGTRVEVIAVEGITLRVKAC
Download sequence
Identical sequences A0A0H3CHP7 A0A0M7DKS7
gi|296101619|ref|YP_003611765.1| WP_013095908.1.40358 WP_013095908.1.55189 WP_013095908.1.92861 YP_003611765.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]