SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296100647|ref|YP_003610793.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296100647|ref|YP_003610793.1|
Domain Number 1 Region: 5-548
Classification Level Classification E-value
Superfamily SIS domain 2.22e-226
Family Phosphoglucose isomerase, PGI 0.00000000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296100647|ref|YP_003610793.1|
Sequence length 549
Comment glucose-6-phosphate isomerase [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MKNINPTQTAAWQALQKHFDEMKDVTIAELFAKDADRFNKFSATFDDLMLVDFSKNRITE
ETLAKLQDLAKETELADAIKSMFSGEKINRTEDRAVLHVALRNRSNTPIIVDGKDVMPEV
NAVLEKMKAFSEAIISGSWKGYTGKAITDVVNIGIGGSDLGPFMVTEALRPYKNHLNMHF
VSNVDGTHIAEVLKNVNPETTLFLVASKTFTTQETMTNAHSARDWFLKIAGDNKHVAKHF
AALSTNGKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIILSVGFDNFVELLSGAHAM
DKHFSTTAPEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKY
VDRNGNAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLSDHHPKL
LSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLEHVVPFKVFEGNRPTNSILLREITPF
SLGALIALYEHKIFTQGAILNIFTFDQWGVELGKQLANRILPELGDDKAISSHDSSTNGL
INRYKAWRA
Download sequence
Identical sequences A0A0H3CE15 A0A0M9IGD9
WP_013095033.1.40358 WP_013095033.1.55189 WP_013095033.1.92861 YP_003610793.1.53031 gi|296100647|ref|YP_003610793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]