SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296101418|ref|YP_003611564.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296101418|ref|YP_003611564.1|
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily SIS domain 2.63e-51
Family mono-SIS domain 0.0000000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296101418|ref|YP_003611564.1|
Sequence length 192
Comment phosphoheptose isomerase [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGYDYIFSRYVEAVGREGDVLLGIST
SGNSGNVIKAIAAAREKGMKVITLTGKDGGKMDGTADVEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
Download sequence
Identical sequences A0A0F0T3N5 A0A0H3CG49 A0A0M7IL99 A0A1B3EY28
gi|392977753|ref|YP_006476341.1| gi|296101418|ref|YP_003611564.1| WP_013095727.1.12136 WP_013095727.1.13165 WP_013095727.1.18853 WP_013095727.1.20094 WP_013095727.1.20623 WP_013095727.1.24479 WP_013095727.1.29048 WP_013095727.1.30503 WP_013095727.1.35593 WP_013095727.1.40063 WP_013095727.1.40358 WP_013095727.1.40370 WP_013095727.1.43855 WP_013095727.1.48585 WP_013095727.1.55189 WP_013095727.1.57771 WP_013095727.1.59627 WP_013095727.1.63227 WP_013095727.1.64562 WP_013095727.1.66160 WP_013095727.1.67678 WP_013095727.1.68081 WP_013095727.1.68308 WP_013095727.1.71263 WP_013095727.1.72211 WP_013095727.1.7582 WP_013095727.1.7743 WP_013095727.1.79105 WP_013095727.1.79553 WP_013095727.1.83767 WP_013095727.1.8463 WP_013095727.1.85406 WP_013095727.1.8730 WP_013095727.1.89813 WP_013095727.1.90350 WP_013095727.1.92861 WP_013095727.1.97911 WP_013095727.1.99766 WP_013095727.1.99932 YP_003611564.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]