SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296101808|ref|YP_003611954.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296101808|ref|YP_003611954.1|
Domain Number 1 Region: 107-290
Classification Level Classification E-value
Superfamily SIS domain 1.35e-42
Family mono-SIS domain 0.01
Further Details:      
 
Domain Number 2 Region: 13-93
Classification Level Classification E-value
Superfamily Homeodomain-like 3.4e-21
Family RpiR-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296101808|ref|YP_003611954.1|
Sequence length 302
Comment DNA-binding transcriptional regulator HexR [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MDEIVYTHERPVNMNMLEKIQFQLEHLSKSERKVAEVILASPAQAIHSSIAALAQDAGVS
EPTVNRFCRSLETRGFPDFKLHLAQSLANGTPYVNRNVDEDDSVDAYTAKIFESAMATLD
HVRQSLDMSSVNRAVDLLTQAKRIAFFGLGSSAAVAHDAMNKFFRFNVPVIYSDDIVLQR
MSCMNCSEDDVVVLISHTGRTKSQVELAQLARENDAMVIALTTAGTPLAREATLAITLDV
PEDTDIYMPMVSRLAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKELLIKSD
VP
Download sequence
Identical sequences A0A0H3CH89 A0A0M7EGW9
YP_003611954.1.53031 gi|296101808|ref|YP_003611954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]