SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296103584|ref|YP_003613730.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296103584|ref|YP_003613730.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily SIS domain 1.31e-38
Family mono-SIS domain 0.0000376
Further Details:      
 
Weak hits

Sequence:  gi|296103584|ref|YP_003613730.1|
Domain Number - Region: 220-270
Classification Level Classification E-value
Superfamily UBA-like 0.0208
Family UBA domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296103584|ref|YP_003613730.1|
Sequence length 287
Comment putative GckR family protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MSIMLTGSVKERRHASTMNIDRLSTLDMLKVIHQDDALISAAITPFLPIIARVVDNAAAT
LSHGGRLVMVGAGPSGCVAKQAADEYAPGKTPVIAITADDDATSYERGVADLQAINFGEH
DMMLAVTVSGKTPWVWGAMRHAWSLGSPVAVITDNAQSEAAQLASMVIAPELGPDVVAGY
LNTKAAIAQKMILSMVTTGLAVRTGRVYSNLRVDLEASSTQWAERQIAIVMEAGGCTRAV
AKAALESCNHNCKTAVLMVLTGLDAWKAHELLAQNNGFIRVALQEAP
Download sequence
Identical sequences A0A0H3CQI6 A0A0M7D853 A0A2A5MZ84
gi|296103584|ref|YP_003613730.1| WP_013097753.1.36454 WP_013097753.1.40358 WP_013097753.1.55189 WP_013097753.1.57771 WP_013097753.1.63227 WP_013097753.1.66160 WP_013097753.1.68081 WP_013097753.1.7743 WP_013097753.1.79105 WP_013097753.1.8730 WP_013097753.1.92861 YP_003613730.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]