SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296104147|ref|YP_003614293.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296104147|ref|YP_003614293.1|
Domain Number 1 Region: 107-273
Classification Level Classification E-value
Superfamily SIS domain 2.43e-28
Family mono-SIS domain 0.0062
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Homeodomain-like 1.42e-17
Family RpiR-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296104147|ref|YP_003614293.1|
Sequence length 277
Comment RpiR family transcriptional regulator [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MTTATSLNELQQQIRDRYDSLSKRLQQVSRYVLDNTNSVAFDTVAVIAERADVPPSTLIR
FANAFDFTGFNEMKQLFRMNLVEETASYSDRARLFREMESEAVPETPLDILQEFARSNAQ
ALQQLAARAEPEMLERAVQLLADADTIYIAGLRRSFSVAAYLTYALSHLECRPILLDGMG
GMLREQISRIKARDIVVSISFSPYAEETVMVSETAASVGARQIVITDSQISPLATFSDLC
FVVKEAQVDAFRSQSATLCLVQSLVVALAYRLGEGEK
Download sequence
Identical sequences A0A0F0TX71 A0A0H3CP22 A0A1S2AGM3
gi|296104147|ref|YP_003614293.1| WP_013098260.1.18853 WP_013098260.1.20061 WP_013098260.1.2052 WP_013098260.1.20569 WP_013098260.1.29048 WP_013098260.1.35593 WP_013098260.1.36454 WP_013098260.1.40063 WP_013098260.1.40358 WP_013098260.1.40370 WP_013098260.1.47648 WP_013098260.1.55189 WP_013098260.1.63227 WP_013098260.1.68308 WP_013098260.1.69799 WP_013098260.1.69838 WP_013098260.1.8337 WP_013098260.1.83562 WP_013098260.1.85406 WP_013098260.1.92861 WP_013098260.1.94918 WP_013098260.1.97718 WP_013098260.1.97911 YP_003614293.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]