SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296104684|ref|YP_003614830.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296104684|ref|YP_003614830.1|
Domain Number 1 Region: 128-266
Classification Level Classification E-value
Superfamily SIS domain 5.12e-23
Family mono-SIS domain 0.023
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000269
Family RpiR-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296104684|ref|YP_003614830.1|
Sequence length 295
Comment RpiR family transcriptional regulator [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MIRKEKGRVDVYGERFRARAHHLTPRLLQVARYINENREAVMEQTAMEIATLLKTSDATV
VRAIQALGFAGLRDLKQTLEQWFGPVVTSSEKISSTVNTLTSDVNASIDFVLEGHQHTCE
VLSQPHNRYAMAQAVSLLAQARQVAIFGIGASGILAEYTARLFSRMGLPAMPLNRTGIGL
AEQLIALQRGDVLVMMAQKSAHREGQTTLREAKRLGIPTILLTNALDSRFSKEASVVIHV
PRGGEKGKIPLHGTVLLCLEMIILSVASTEPQRTIKSMKRINEFHRGLKPGKKSG
Download sequence
Identical sequences A0A0F0TUT5 A0A0H3CRQ5 A0A0M7EAS6 A0A1B3F515
gi|296104684|ref|YP_003614830.1| WP_013098734.1.18853 WP_013098734.1.20623 WP_013098734.1.24479 WP_013098734.1.30503 WP_013098734.1.35593 WP_013098734.1.40063 WP_013098734.1.40358 WP_013098734.1.40370 WP_013098734.1.55189 WP_013098734.1.59627 WP_013098734.1.64562 WP_013098734.1.72211 WP_013098734.1.7582 WP_013098734.1.7743 WP_013098734.1.79553 WP_013098734.1.83767 WP_013098734.1.8463 WP_013098734.1.85406 WP_013098734.1.8730 WP_013098734.1.92861 WP_013098734.1.99932 YP_003614830.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]