SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296104863|ref|YP_003615009.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296104863|ref|YP_003615009.1|
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily SIS domain 4.45e-51
Family mono-SIS domain 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296104863|ref|YP_003615009.1|
Sequence length 196
Comment DnaA initiator-associating protein DiaA [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MLERIKVCFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILCCGNGTSAANAQHFA
ASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEIYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGPQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQDD
Download sequence
Identical sequences A0A066P345 A0A0E1JDS8 A0A0E2M5D2 A0A0F0YD81 A0A0F1BBN2 A0A0F1WWT9 A0A0F4BPI7 A0A0H3CR40 A0A0J1VI95 A0A0J6MAG1 A0A0M2BXF6 A0A0M2GBM8 A0A0M7E275 A0A0P8NBM4 A0A0T5XRH0 A0A0V9E620 A0A0W2B616 A0A0W2H8C4 A0A0X4EIL4 A0A145XQY2 A0A162SBD6 A0A167FLM3 A0A167RNP5 A0A181Y5N2 A0A198H148 A0A1A9FET7 A0A1E5MTF3 A0A1J5W9N4 A0A1M5SVY8 A0A1V6MCF8 A0A229HS66 A0A2I1ZLH1 A0A2I2B547 A0A2I5HXS3 A0A2I6KFI3 A0A2J5VNJ8 A0A2J7T6F0 F5S2F1 G2SCM1 G8LFL1 V3D1B1 V3R781 W0BGU7 W7P3S1
gi|345300953|ref|YP_004830311.1| WP_003861754.1.100009 WP_003861754.1.10017 WP_003861754.1.100262 WP_003861754.1.100526 WP_003861754.1.100591 WP_003861754.1.100784 WP_003861754.1.100876 WP_003861754.1.101043 WP_003861754.1.101104 WP_003861754.1.10113 WP_003861754.1.101311 WP_003861754.1.101814 WP_003861754.1.101854 WP_003861754.1.101958 WP_003861754.1.10333 WP_003861754.1.10438 WP_003861754.1.10612 WP_003861754.1.10864 WP_003861754.1.10865 WP_003861754.1.10971 WP_003861754.1.11529 WP_003861754.1.11901 WP_003861754.1.12196 WP_003861754.1.12425 WP_003861754.1.13165 WP_003861754.1.13522 WP_003861754.1.13582 WP_003861754.1.1359 WP_003861754.1.13869 WP_003861754.1.13935 WP_003861754.1.14227 WP_003861754.1.14229 WP_003861754.1.14348 WP_003861754.1.14400 WP_003861754.1.14427 WP_003861754.1.14449 WP_003861754.1.14619 WP_003861754.1.14692 WP_003861754.1.14856 WP_003861754.1.15044 WP_003861754.1.15096 WP_003861754.1.15133 WP_003861754.1.15158 WP_003861754.1.1531 WP_003861754.1.15357 WP_003861754.1.15580 WP_003861754.1.15748 WP_003861754.1.15790 WP_003861754.1.16030 WP_003861754.1.16122 WP_003861754.1.16247 WP_003861754.1.16310 WP_003861754.1.16350 WP_003861754.1.16587 WP_003861754.1.16848 WP_003861754.1.16853 WP_003861754.1.16863 WP_003861754.1.16943 WP_003861754.1.17292 WP_003861754.1.17437 WP_003861754.1.17469 WP_003861754.1.17507 WP_003861754.1.17510 WP_003861754.1.17804 WP_003861754.1.18075 WP_003861754.1.18305 WP_003861754.1.18332 WP_003861754.1.18353 WP_003861754.1.18374 WP_003861754.1.18398 WP_003861754.1.18491 WP_003861754.1.18518 WP_003861754.1.18544 WP_003861754.1.18660 WP_003861754.1.19007 WP_003861754.1.19176 WP_003861754.1.19404 WP_003861754.1.19459 WP_003861754.1.19666 WP_003861754.1.19678 WP_003861754.1.19903 WP_003861754.1.19966 WP_003861754.1.19991 WP_003861754.1.20061 WP_003861754.1.20094 WP_003861754.1.20346 WP_003861754.1.20450 WP_003861754.1.2049 WP_003861754.1.2052 WP_003861754.1.20569 WP_003861754.1.20623 WP_003861754.1.20871 WP_003861754.1.20995 WP_003861754.1.2110 WP_003861754.1.21483 WP_003861754.1.21649 WP_003861754.1.219 WP_003861754.1.21905 WP_003861754.1.21922 WP_003861754.1.2196 WP_003861754.1.21963 WP_003861754.1.22178 WP_003861754.1.22430 WP_003861754.1.22646 WP_003861754.1.22849 WP_003861754.1.23556 WP_003861754.1.23558 WP_003861754.1.24243 WP_003861754.1.24321 WP_003861754.1.24603 WP_003861754.1.24661 WP_003861754.1.25172 WP_003861754.1.25550 WP_003861754.1.25654 WP_003861754.1.25876 WP_003861754.1.2639 WP_003861754.1.26530 WP_003861754.1.26596 WP_003861754.1.26836 WP_003861754.1.26874 WP_003861754.1.27089 WP_003861754.1.27212 WP_003861754.1.27591 WP_003861754.1.27641 WP_003861754.1.28036 WP_003861754.1.28077 WP_003861754.1.29066 WP_003861754.1.29371 WP_003861754.1.29409 WP_003861754.1.29478 WP_003861754.1.29681 WP_003861754.1.29739 WP_003861754.1.2977 WP_003861754.1.30157 WP_003861754.1.30371 WP_003861754.1.30412 WP_003861754.1.30503 WP_003861754.1.30551 WP_003861754.1.30644 WP_003861754.1.30839 WP_003861754.1.30852 WP_003861754.1.31249 WP_003861754.1.31255 WP_003861754.1.31268 WP_003861754.1.31327 WP_003861754.1.31470 WP_003861754.1.3154 WP_003861754.1.31622 WP_003861754.1.31891 WP_003861754.1.31942 WP_003861754.1.31957 WP_003861754.1.31963 WP_003861754.1.3218 WP_003861754.1.32220 WP_003861754.1.32256 WP_003861754.1.3243 WP_003861754.1.32901 WP_003861754.1.3292 WP_003861754.1.32958 WP_003861754.1.33390 WP_003861754.1.33497 WP_003861754.1.33500 WP_003861754.1.33611 WP_003861754.1.34582 WP_003861754.1.34623 WP_003861754.1.34788 WP_003861754.1.34807 WP_003861754.1.34867 WP_003861754.1.35511 WP_003861754.1.3558 WP_003861754.1.35667 WP_003861754.1.36012 WP_003861754.1.36120 WP_003861754.1.36339 WP_003861754.1.36454 WP_003861754.1.36466 WP_003861754.1.36758 WP_003861754.1.36787 WP_003861754.1.3683 WP_003861754.1.37315 WP_003861754.1.37462 WP_003861754.1.38255 WP_003861754.1.38635 WP_003861754.1.39185 WP_003861754.1.39603 WP_003861754.1.39855 WP_003861754.1.39969 WP_003861754.1.40432 WP_003861754.1.40638 WP_003861754.1.40704 WP_003861754.1.40764 WP_003861754.1.40980 WP_003861754.1.41014 WP_003861754.1.4113 WP_003861754.1.41385 WP_003861754.1.41870 WP_003861754.1.41953 WP_003861754.1.42124 WP_003861754.1.42420 WP_003861754.1.4251 WP_003861754.1.42691 WP_003861754.1.42697 WP_003861754.1.42742 WP_003861754.1.42775 WP_003861754.1.42793 WP_003861754.1.42968 WP_003861754.1.43063 WP_003861754.1.43497 WP_003861754.1.43620 WP_003861754.1.43656 WP_003861754.1.43735 WP_003861754.1.43859 WP_003861754.1.44025 WP_003861754.1.4418 WP_003861754.1.44323 WP_003861754.1.44459 WP_003861754.1.44522 WP_003861754.1.44669 WP_003861754.1.44670 WP_003861754.1.44834 WP_003861754.1.45046 WP_003861754.1.45230 WP_003861754.1.45270 WP_003861754.1.45288 WP_003861754.1.4551 WP_003861754.1.45695 WP_003861754.1.45786 WP_003861754.1.45800 WP_003861754.1.45816 WP_003861754.1.4608 WP_003861754.1.4616 WP_003861754.1.46546 WP_003861754.1.46717 WP_003861754.1.46843 WP_003861754.1.46853 WP_003861754.1.4737 WP_003861754.1.47648 WP_003861754.1.48221 WP_003861754.1.48569 WP_003861754.1.48585 WP_003861754.1.49014 WP_003861754.1.49240 WP_003861754.1.49378 WP_003861754.1.49440 WP_003861754.1.49454 WP_003861754.1.49502 WP_003861754.1.49618 WP_003861754.1.49652 WP_003861754.1.49797 WP_003861754.1.49826 WP_003861754.1.49946 WP_003861754.1.49974 WP_003861754.1.50391 WP_003861754.1.50622 WP_003861754.1.51121 WP_003861754.1.51695 WP_003861754.1.51737 WP_003861754.1.51853 WP_003861754.1.51918 WP_003861754.1.52388 WP_003861754.1.52483 WP_003861754.1.52484 WP_003861754.1.52672 WP_003861754.1.5270 WP_003861754.1.52764 WP_003861754.1.52938 WP_003861754.1.538 WP_003861754.1.54084 WP_003861754.1.54584 WP_003861754.1.54756 WP_003861754.1.54846 WP_003861754.1.54933 WP_003861754.1.55168 WP_003861754.1.55300 WP_003861754.1.55600 WP_003861754.1.55681 WP_003861754.1.55705 WP_003861754.1.56051 WP_003861754.1.56233 WP_003861754.1.56418 WP_003861754.1.56578 WP_003861754.1.56618 WP_003861754.1.56693 WP_003861754.1.56802 WP_003861754.1.56919 WP_003861754.1.57317 WP_003861754.1.57391 WP_003861754.1.57436 WP_003861754.1.57748 WP_003861754.1.57771 WP_003861754.1.57779 WP_003861754.1.5823 WP_003861754.1.58439 WP_003861754.1.58693 WP_003861754.1.58732 WP_003861754.1.58757 WP_003861754.1.59053 WP_003861754.1.59323 WP_003861754.1.59330 WP_003861754.1.59342 WP_003861754.1.59379 WP_003861754.1.59387 WP_003861754.1.59408 WP_003861754.1.59627 WP_003861754.1.59653 WP_003861754.1.59674 WP_003861754.1.59818 WP_003861754.1.59923 WP_003861754.1.60053 WP_003861754.1.60141 WP_003861754.1.60748 WP_003861754.1.60984 WP_003861754.1.61192 WP_003861754.1.61305 WP_003861754.1.61332 WP_003861754.1.61367 WP_003861754.1.61545 WP_003861754.1.61725 WP_003861754.1.61859 WP_003861754.1.61909 WP_003861754.1.62117 WP_003861754.1.62542 WP_003861754.1.62791 WP_003861754.1.62870 WP_003861754.1.62887 WP_003861754.1.6296 WP_003861754.1.63060 WP_003861754.1.63223 WP_003861754.1.63447 WP_003861754.1.63547 WP_003861754.1.63572 WP_003861754.1.64183 WP_003861754.1.64354 WP_003861754.1.64562 WP_003861754.1.64612 WP_003861754.1.64623 WP_003861754.1.65273 WP_003861754.1.65377 WP_003861754.1.65594 WP_003861754.1.65618 WP_003861754.1.65640 WP_003861754.1.65815 WP_003861754.1.65877 WP_003861754.1.66231 WP_003861754.1.6631 WP_003861754.1.664 WP_003861754.1.66944 WP_003861754.1.66987 WP_003861754.1.67088 WP_003861754.1.67439 WP_003861754.1.67474 WP_003861754.1.67611 WP_003861754.1.67854 WP_003861754.1.680 WP_003861754.1.68081 WP_003861754.1.68097 WP_003861754.1.68405 WP_003861754.1.68593 WP_003861754.1.68950 WP_003861754.1.69141 WP_003861754.1.69196 WP_003861754.1.69567 WP_003861754.1.69799 WP_003861754.1.69874 WP_003861754.1.70099 WP_003861754.1.70186 WP_003861754.1.70819 WP_003861754.1.70825 WP_003861754.1.70898 WP_003861754.1.70983 WP_003861754.1.71244 WP_003861754.1.71263 WP_003861754.1.71318 WP_003861754.1.71445 WP_003861754.1.71577 WP_003861754.1.71754 WP_003861754.1.71867 WP_003861754.1.72210 WP_003861754.1.72211 WP_003861754.1.72354 WP_003861754.1.72717 WP_003861754.1.72757 WP_003861754.1.72955 WP_003861754.1.73371 WP_003861754.1.73493 WP_003861754.1.7354 WP_003861754.1.73597 WP_003861754.1.74068 WP_003861754.1.74076 WP_003861754.1.74146 WP_003861754.1.74514 WP_003861754.1.74669 WP_003861754.1.74744 WP_003861754.1.7483 WP_003861754.1.74910 WP_003861754.1.75095 WP_003861754.1.75172 WP_003861754.1.75345 WP_003861754.1.75348 WP_003861754.1.75467 WP_003861754.1.75512 WP_003861754.1.75531 WP_003861754.1.75559 WP_003861754.1.7569 WP_003861754.1.75763 WP_003861754.1.75813 WP_003861754.1.75814 WP_003861754.1.7582 WP_003861754.1.75846 WP_003861754.1.76483 WP_003861754.1.76665 WP_003861754.1.76700 WP_003861754.1.76741 WP_003861754.1.77076 WP_003861754.1.77126 WP_003861754.1.77213 WP_003861754.1.7722 WP_003861754.1.7743 WP_003861754.1.77438 WP_003861754.1.77443 WP_003861754.1.77910 WP_003861754.1.78272 WP_003861754.1.78358 WP_003861754.1.78743 WP_003861754.1.78853 WP_003861754.1.79019 WP_003861754.1.79247 WP_003861754.1.79393 WP_003861754.1.79425 WP_003861754.1.79553 WP_003861754.1.79670 WP_003861754.1.79753 WP_003861754.1.80075 WP_003861754.1.80110 WP_003861754.1.80172 WP_003861754.1.80337 WP_003861754.1.80541 WP_003861754.1.80869 WP_003861754.1.8094 WP_003861754.1.81254 WP_003861754.1.81352 WP_003861754.1.81363 WP_003861754.1.81463 WP_003861754.1.81916 WP_003861754.1.83075 WP_003861754.1.83095 WP_003861754.1.83100 WP_003861754.1.83133 WP_003861754.1.83194 WP_003861754.1.83202 WP_003861754.1.8337 WP_003861754.1.83391 WP_003861754.1.8355 WP_003861754.1.83562 WP_003861754.1.83675 WP_003861754.1.83767 WP_003861754.1.83856 WP_003861754.1.83860 WP_003861754.1.83903 WP_003861754.1.83981 WP_003861754.1.84479 WP_003861754.1.84709 WP_003861754.1.84817 WP_003861754.1.85058 WP_003861754.1.85066 WP_003861754.1.85159 WP_003861754.1.85482 WP_003861754.1.85794 WP_003861754.1.8588 WP_003861754.1.86083 WP_003861754.1.86111 WP_003861754.1.86251 WP_003861754.1.864 WP_003861754.1.86421 WP_003861754.1.86567 WP_003861754.1.86809 WP_003861754.1.86912 WP_003861754.1.86954 WP_003861754.1.87359 WP_003861754.1.87535 WP_003861754.1.87781 WP_003861754.1.87950 WP_003861754.1.88105 WP_003861754.1.88132 WP_003861754.1.88202 WP_003861754.1.88302 WP_003861754.1.88432 WP_003861754.1.8866 WP_003861754.1.88665 WP_003861754.1.88822 WP_003861754.1.88919 WP_003861754.1.88938 WP_003861754.1.88978 WP_003861754.1.89338 WP_003861754.1.89363 WP_003861754.1.89579 WP_003861754.1.89813 WP_003861754.1.90049 WP_003861754.1.90210 WP_003861754.1.9042 WP_003861754.1.90462 WP_003861754.1.9052 WP_003861754.1.90528 WP_003861754.1.90765 WP_003861754.1.90833 WP_003861754.1.90966 WP_003861754.1.91166 WP_003861754.1.91323 WP_003861754.1.91359 WP_003861754.1.91679 WP_003861754.1.92050 WP_003861754.1.92214 WP_003861754.1.92287 WP_003861754.1.92699 WP_003861754.1.92861 WP_003861754.1.93429 WP_003861754.1.93660 WP_003861754.1.93772 WP_003861754.1.93925 WP_003861754.1.9451 WP_003861754.1.94884 WP_003861754.1.94918 WP_003861754.1.95910 WP_003861754.1.95960 WP_003861754.1.96009 WP_003861754.1.96082 WP_003861754.1.96315 WP_003861754.1.96463 WP_003861754.1.96776 WP_003861754.1.96847 WP_003861754.1.96919 WP_003861754.1.9702 WP_003861754.1.97115 WP_003861754.1.97251 WP_003861754.1.97431 WP_003861754.1.97718 WP_003861754.1.97924 WP_003861754.1.97933 WP_003861754.1.98015 WP_003861754.1.98165 WP_003861754.1.98325 WP_003861754.1.9846 WP_003861754.1.98616 WP_003861754.1.98785 WP_003861754.1.98887 WP_003861754.1.98962 WP_003861754.1.992 WP_003861754.1.99235 WP_003861754.1.99807 WP_003861754.1.99947 YP_003615009.1.53031 gi|392980832|ref|YP_006479420.1| gi|401765342|ref|YP_006580349.1| gi|296104863|ref|YP_003615009.1| gi|365972239|ref|YP_004953800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]