SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296104910|ref|YP_003615056.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296104910|ref|YP_003615056.1|
Domain Number 1 Region: 13-326
Classification Level Classification E-value
Superfamily SIS domain 1.87e-65
Family mono-SIS domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296104910|ref|YP_003615056.1|
Sequence length 328
Comment D-arabinose 5-phosphate isomerase [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MSQIELQPGFDFQKAGKDVLEIEREGLAQLDQYINQDFSLACEKMFYCVGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTPQDVVIALSNSGESNEILALIPVLK
RLQVPLICMTSRPESSMARAADIHLCVKVPKEACPLGLAPTSSTTAALVMGDALAVALLE
ARGFTPEDFALSHPGGALGRKLLLRVNDIMHTGDEIPHVSKEASLRDALLEITRKNLGMT
VVCDDLMKIEGIFTDGDLRRVFDMGVDVRTLGIADVMTPGGIRVRPGTLAVDVLNLMQSR
HITSVMVADGDQLLGVVHMHDLLRAGVV
Download sequence
Identical sequences A0A0H3CS81 A0A0M7E0I7
gi|296104910|ref|YP_003615056.1| WP_013098937.1.40358 WP_013098937.1.55189 WP_013098937.1.92861 YP_003615056.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]