SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300697719|ref|YP_003748380.1| from Ralstonia solanacearum CFBP2957

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300697719|ref|YP_003748380.1|
Domain Number 1 Region: 99-263
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.44e-41
Family PA2201 C-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300697719|ref|YP_003748380.1|
Sequence length 304
Comment conserved protein of unknown function [Ralstonia solanacearum CFBP2957]
Sequence
MMVRANLGDTAYWNKWVDYGEARIAEMISRAKEPSRNPSYRPQYVYEITRESYEQMLRRY
SRGDSVRELAHYFPTLLDTWEEAERLGKDVWTEEQQYTRHAWAVNFDHYVVCFWLVGLAL
ALDIPNDQWKRLIDLVGNEGEDILLDGIIASRKKDRKINAKLCYPKPYQRLLDAVNAPKA
EHGKSLLVFVENWYAELDRPPKKGLSDQTAMYDRPYWHRYGDQNFEGGAYFGRWCVEAVA
AVKAFGIDDSLCLGHPNYPGDLLRPDGPGTHPVHSAQEGAGSGEVGEAEAAVKRSGWLGR
LFGK
Download sequence
Identical sequences D8P507
gi|300697719|ref|YP_003748380.1| gi|300697719|ref|YP_003748380.1|NC_014309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]