SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300702822|ref|YP_003744423.1| from Ralstonia solanacearum CFBP2957

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300702822|ref|YP_003744423.1|
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.06e-32
Family Frataxin-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300702822|ref|YP_003744423.1|
Sequence length 113
Comment frataxin, iron-binding and oxidizing protein [Ralstonia solanacearum CFBP2957]
Sequence
MPPLTESEFLALADAELGRIERTVERAADEADADIEIGRVGNVLTLEFDDGSKIIINSQA
PMQELWVAARAGGFHFRRNDGRWVDTRTGEELYVALSRYVSQQSDADVSLVAD
Download sequence
Identical sequences A0A177RS33 D8NMU2
WP_003271400.1.63744 WP_003271400.1.77028 WP_003271400.1.85682 WP_003271400.1.9888 gi|300702822|ref|YP_003744423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]