SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300696885|ref|YP_003747546.1| from Ralstonia solanacearum CFBP2957

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300696885|ref|YP_003747546.1|
Domain Number 1 Region: 475-494,547-789
Classification Level Classification E-value
Superfamily HAD-like 3.73e-52
Family Meta-cation ATPase, catalytic domain P 0.00064
Further Details:      
 
Domain Number 2 Region: 287-374
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.35e-20
Family Calcium ATPase, transduction domain A 0.0048
Further Details:      
 
Domain Number 3 Region: 215-278,376-467
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.44e-16
Family Calcium ATPase, transmembrane domain M 0.009
Further Details:      
 
Domain Number 4 Region: 81-145
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000114
Family HMA, heavy metal-associated domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300696885|ref|YP_003747546.1|
Sequence length 797
Comment cation (cadmium)-transporting ATPase (Cadmium efflux ATPase) [Ralstonia solanacearum CFBP2957]
Sequence
MTSPDHVDAKPAQSGCGGCCGHDHPAARDTAAHPAPAHAPRPGHDQAHEPRAASTPATFA
TPADAADADAAAAALARASGRTRLRIAQMDCPTEERMIRARLGNAAGVVALDFNLLERHL
TIHHTVDDIAPFLEALRAIGMDGEVLEAHDRAAAVPEPAPGGVSRRAWLLGVGGVAAFGA
EAIAWSLGDHSWPVLGLALASIGLAGGPTLRKGWIALRAFTFNINFLMAVAVIGALLIGK
WAEAAMVIFLFAVAEAIEARALVRARDAVRALTAIAPDTADASDGAGGWRAVAVGAVALG
TRLRVRTGSRVPVDARIVAGRAALDESPVTGESLPVEKAIGDAILAGTIVTDGVIEAEAT
AVAADSTLARIAAAIQEAQAQRAPTQRFVDQFASIYTPAMMLLALAVAVIGPQVTADGWL
AWAYRALVLLVIACPCALVISTPVTVVSGLAAAARRGIVVKGGVYLESGRRLRALALDKT
GTLTAGRPVLDTVALPDGTSRPVASLDAATDVVQLRALGVAAALDAHTTHPIALAIVQAA
AAHGAAQDRPVEALSVLPGRGVVGTLDGVRWHLGNAALVAERGWDTPAWRQAAEQLQAVG
MSAVTLCDAGGAVALFGVRDRERAESAEAIAGLRALQVHPVMLTGDDRRAAQAIAQAVGI
DAVHAEQLPADKQRVVGELAAQYGFVGMVGDGINDAPALARADIGFAMGAAGTATALEAA
DVAIMDDDPRKLAAFIRISRRTVAVLRQNIALALGIKAVFLALAVAGEATLWMAIFADVG
ASLLVVFNGLRVMRVRA
Download sequence
Identical sequences D8P2J3
gi|300696885|ref|YP_003747546.1| gi|300696885|ref|YP_003747546.1|NC_014309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]