SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300022291|ref|YP_003754902.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300022291|ref|YP_003754902.1|
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-47
Family Methylesterase CheB, C-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 281-462
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.9e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 211-282
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000116
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0067
Further Details:      
 
Domain Number 4 Region: 713-833
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000099
Family Flavin-binding PAS domain 0.023
Further Details:      
 
Domain Number 5 Region: 644-732
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000942
Family FCH domain 0.046
Further Details:      
 
Weak hits

Sequence:  gi|300022291|ref|YP_003754902.1|
Domain Number - Region: 516-617
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00514
Family Heme-binding PAS domain 0.079
Further Details:      
 
Domain Number - Region: 933-988
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0191
Family Histidine kinase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300022291|ref|YP_003754902.1|
Sequence length 1032
Comment MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MTSDATPLAPSSSINAVPVTGIGASAGGIPALQAFFKALPSDTGAAYVVILHLDPEHQSD
LAQILSLATSMPVTEVGDATAIVANHIYVISPNRKLLISASQISTAPFDEPRGQRAPVDS
FFRLLARQHGDGFAIIMSGAGSDGSNGVKDIKENGGLVLVQDPAEAAFSSMPRAAIASGV
ADLILPIRDIALRIPELIRKKGQLHAEQNAGSNEDALKRILGFLRLKTGHDFSNYKRPTV
VRRLARRMQVTRSDNIEDYMAHLRSRPEEIQALFADLLISVTCFFRDASAFDYLSRDIIP
KLFTNREPDSVLRIWVPGCATGEEVYSLGILILEEAARRELKPEIQLFASDLDSTALATA
GEARYPLSIKSDVSEQRLQRYFTREGDNYRIKREVRDLVVFAAHSLLRDPPFSHIDLISC
RNLLIYLDRDLQQQVASTFHYALRPGGYLFLGSSETIDGNTLFRIVDRDTRIYQALERPR
DKLPPLPRILTGPTIVGPPSRPVLRRSPSTNDMSMHRQALEATAPPSIMIDEAHQIVTLS
ETAGRFLLHSGGPMTSEAPDIVRPELRPDLRAGLHRAFEQNQATLTMPIPVRFNGDVHAV
SLQIRPVQKENDARVALVLFLEGGPVERKNDNRTTDDSAPTTIVTELREELLATRERLRA
SRDQYEAVTEELRASNEELQSMNEEYRSTSEELETSKEELQSINEELQTLNNELKLKLES
VSRAHNDLQNLMAATDLATLFLDPDMRINRFTPRLAQIFNVVNGDEGRPISNFTNKLKYN
DLARDGKRVLADLTTLEKTIESTDGRWFLLRVRPYRTLDDRIEGVVMTFVDITEQRKMEE
HWQERQHLLLAELSHRFKNIYAVVQAIAGQSLRDSGATDSTRNTLNSRLRALAISHDLLV
QNEWQSVAFERLLSEQLTGMTDRFRFEGPHVELPGELATPLALALHELETNAVKYGALSN
KDGKVTLTWKKSEKGGKKRLLITWSEAGGPKVSEPTRRGFGSSLLEKGLPNAEVTREFRV
TGVICTIDCLLE
Download sequence
Identical sequences D8JTL9
gi|300022291|ref|YP_003754902.1| WP_013214796.1.30340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]