SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300023510|ref|YP_003756121.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300023510|ref|YP_003756121.1|
Domain Number 1 Region: 16-270,360-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.11e-56
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000074
Further Details:      
 
Domain Number 2 Region: 244-356
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.06e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00016
Further Details:      
 
Domain Number 3 Region: 440-529
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 4.84e-26
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300023510|ref|YP_003756121.1|
Sequence length 550
Comment L-aspartate oxidase [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MTAQRQREARSFVPFEGKPGPGDVVIIGAGLAGLFTALKLAPLPVTVIAAAPLGEGASSM
WAQGGIAAAVGEGDSTDKHAADTIEAGGGIVDTQVAHVVADEGPDRIRDLLSYGVPFDRD
LEGHYVLSKEAAHSEKRVVRVSGDRAGAAIMQALIAAVRNTPSIRVLEGYEADGLIADND
RIEGIRLIRSRTHGTGSYVFVPASAIVLATGGVGALFALTTNPSYAKGEAIAMAARVGAV
IADPEFVQFHPTAIDAGIDPAPLATEALRGEGATLVNSLGERFMLAIDPRGELAPRDVVA
RGVFNELNAGRGVFLDCREAIGAHFKDEFPTVWSHCQRAGIDPAKDLIPVAPAEHYHMGG
IATDLRGRTSLAGLWAVGEVASTGLHGANRLASNSLLEAVVFGARAAADIRAYLPHDRVG
HFVHPRRVPGNRASAPEQRSEAIDTLRAIMTKHVGVQRSAKGLKAALAALKKLDESAADD
TVLSNMILTARLIAAAALARKESRGGHYRVDYPAADPAFAKRTFITVEDLKATEAAPRAS
RSVSAAACRP
Download sequence
Identical sequences D8JPR6
gi|300023510|ref|YP_003756121.1| WP_013215959.1.30340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]