SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300023732|ref|YP_003756343.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300023732|ref|YP_003756343.1|
Domain Number 1 Region: 28-362
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.32e-67
Family AAT-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300023732|ref|YP_003756343.1|
Sequence length 370
Comment class I and II aminotransferase [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MSRPPFTPTIASLPKLVPFVGPEALERARGRPFSARLGANESIFGSSPKAVAAMREAAAE
NWKYSDPENFELRSAIADHHGVAIENVVVGEGIDGLLGLTCTMFLTPGAHVVTTDGAYPT
FNFHVRAHGGVLDLVPMHDMREDVPRLIESAKALSARMLYVSNPNNPMGSWWPAEAMTQF
IGALAPETLLILDEAYVETAPEGTAPPIDISNPQVVHYRTFSKAYGLAGARIGYAIGESS
VIEAFDKVRNHYGINRVGQIGALAAIRDQAYLRDAVGAIAAARERIAAIASANGLSPLPS
AANFVAIDCGRDAAFAEHVLKALLDRDVFVRKPIAKGIDHCIRVSCGRDEDLDVFAKALP
AAIEDARRLS
Download sequence
Identical sequences D8JR37
WP_013216181.1.30340 gi|300023732|ref|YP_003756343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]