SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300023861|ref|YP_003756472.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300023861|ref|YP_003756472.1|
Domain Number 1 Region: 24-422
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.5e-124
Family Cystathionine synthase-like 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300023861|ref|YP_003756472.1|
Sequence length 427
Comment SufS subfamily cysteine desulfurase [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MGSETKVAAVRSAASQSGLTAAPYDVELIRADFPILFREVHDRPLVYLDNGASAQKPRSV
IEAMDYAYRFEYANVHRGLHHLSNVATDHYETARETARRFLNAEHSDEIIFTRNATGAIN
LVARSFGEPRIAEGDEIVITIMEHHANIVPWHFLRERNGAVLKWAPMTDRGELLVDKLDQ
LITKRTKLVAVTHMSNVLGTINPVKEIVRIAHAKGVPVLIDGSQSAVHMTVDVRDLDCDF
YVFTGHKTYGPSGIGVLYAKREHLESMPPYEGGGDMIEHVSVDRITYAKPPHRFEAGTPA
IVEAVGLNAALNYMMQIGRDRIARYEAELGAYAAERLGELPWLKLYGTAPGKGAIFSFTI
DGLHPHDVSTIIDRSGVAIRAGHHCAQPLMERLGVTATCRASFALYNTKAEADALVTALT
KAHDLFT
Download sequence
Identical sequences D8JRT3
WP_013216310.1.30340 gi|300023861|ref|YP_003756472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]