SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300024699|ref|YP_003757310.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300024699|ref|YP_003757310.1|
Domain Number 1 Region: 17-370
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.06e-91
Family GABA-aminotransferase-like 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300024699|ref|YP_003757310.1|
Sequence length 377
Comment 8-amino-7-oxononanoate synthase [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MPSNHERALDALLRRGRLRSLDTPAGIDFTSNDYLGLAQSRALADAVVAAIERGVPIGAG
GSRLLRGNHPEHEALEAEAAAFFGAETALFFGGGFIANTALMATLPSRGDLIVYDELIHA
SVHDGMRLSKAEATAARHNDPQSIEDAIKTWRAAGGDGQPWIVVESLYSMDGDRAPIDEL
AQLATRHDAMLIVDEAHATGVFGPEGRGFAAHLEGAANVITLHTCGKALGVMGALVLAPK
TIRDFLLNRARAFIYATAPSPLVASAVRAALQICRDEPARRERLHGLIAFAERELKSKTR
FAPSGSQIQPIIIGADNSALALAAAMKARGYDIRAIRPPTVPEGTARLRLTITLNTDEAV
LSRLIGDLVTAEAEVAA
Download sequence
Identical sequences D8JWN1
WP_013217148.1.30340 gi|300024699|ref|YP_003757310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]