SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300024741|ref|YP_003757352.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300024741|ref|YP_003757352.1|
Domain Number 1 Region: 21-281,380-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-78
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000211
Further Details:      
 
Domain Number 2 Region: 472-615
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.23e-48
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 258-376
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.44e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300024741|ref|YP_003757352.1|
Sequence length 615
Comment succinate dehydrogenase, flavoprotein subunit [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MANTNGKTNGASAAPAVGGKAYPIVDHQYDVVVVGAGGAGLRATLGCAEAGLKTACVTKV
FPTRSHTVAAQGGVAAALGNMGPDDWRWHMYDTVKGSDWLGDQDAIEYLCRHAPAAVYEL
EHYGVPFSRTEDGKIYQRPFGGMTTDFGEGPPAQRTCAAADRTGHAMLHTLYGQSLRYAA
EFFVEYFALDLIMDRDGACRGIIALSLEDGTLHRFRAKKTILATGGYGRTYFSCTSAHTC
TGDGNAMVLRAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSKGERFMERYAP
HAKDLASRDVVSRSMTVEIREGRGVGAEGDHIFLHLDHLDPKILAERLPGITESAKVFAG
VDLRRQPIPVLPTVHYNMGGIPTNYHGEVLTKKDGNPDHVVPGLMAIGEAACVSVHGANR
LGSNSLIDLVVFGRAAGLRCAETIETGAMQTELPKDADDKILDRLDRFRFAKGSTPTSAL
RLRMQKTMQANCAVFRDGPVLKEGVEKIAAVWRDAADISVTDRSLIWNSDLVETLEFDNL
IAQAAVTVTGAENRKESRGAHAREDYPKRDDVNWMKHTLAWADYATKTVKLDERPVHTRT
MTNEVKYIEPKARVY
Download sequence
Identical sequences D8JWS3
gi|300024741|ref|YP_003757352.1| WP_013217190.1.30340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]