SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15594760|ref|NP_212549.1| from Borrelia burgdorferi B31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15594760|ref|NP_212549.1|
Domain Number 1 Region: 187-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-60
Family Methylesterase CheB, C-terminal domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 4-103
Classification Level Classification E-value
Superfamily CheY-like 0.0000000187
Family CheY-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15594760|ref|NP_212549.1|
Sequence length 375
Comment chemotaxis protein CheB [Borrelia burgdorferi B31]
Sequence
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNSKFATNKLKKHKPEVILMNLEE
NNIKDILFLEEKNSLNKTIPIVVTSSNQNLINIAASKGADDLILVSKNKKSHEIKKEQII
NSLLAYGSISIKNKIACNKDMKTKNYERANFILNHKNDISSLNQLEEHAKEKTLNEKEIK
KLKLRKFDIIAIGVSAGGPVALKSILPEIPESFPPIIIVQHMPKGFTEEFAKNLNNLCKI
SVKETTNNEILKQGYAYISSGGYHTKIKKIDGNYQIKTLDGKHINGHKPSIGVLFQSIAE
IAKDKAIAIIMTGMGNDGSREIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LSHMVKLLKAILINS
Download sequence
Identical sequences A0A0E1U8H0 A0A0H3C427 A0A2J9PBX2 O51376
gi|218249821|ref|YP_002374929.1| gi|530321327|ref|YP_008407593.1| gi|387827327|ref|YP_005806609.1| gi|15594760|ref|NP_212549.1| 224326.BB0415 445985.BbuZS7_0417 NP_212549.1.46978 WP_002657881.1.100372 WP_002657881.1.1709 WP_002657881.1.23946 WP_002657881.1.31711 WP_002657881.1.44797 WP_002657881.1.53248 WP_002657881.1.58911 WP_002657881.1.72823 WP_002657881.1.75039 WP_002657881.1.86244 WP_002657881.1.91101 WP_002657881.1.95407 WP_002657881.1.96757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]