SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42522306|ref|NP_967686.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42522306|ref|NP_967686.1|
Domain Number 1 Region: 14-124
Classification Level Classification E-value
Superfamily DOPA-like 2.35e-37
Family DOPA dioxygenase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42522306|ref|NP_967686.1|
Sequence length 125
Comment DOPA-dioxygenase-related protein [Bdellovibrio bacteriovorus HD100]
Sequence
MQKTYTVNSKLLPAGFPREFDAHIYFESASLTKAEHLRDEAIRMFEGKKVFVGEMIPEAI
GPHPVPMFEINFPKEHFTEVVLWLMHERGDLSVLVHELTGDDLYDHTQAAMWLGPAVELK
YDRFK
Download sequence
Identical sequences Q6MPW8
WP_011163281.1.10133 WP_011163281.1.54414 gi|42522306|ref|NP_967686.1| 264462.Bd0721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]