SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42522777|ref|NP_968157.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42522777|ref|NP_968157.1|
Domain Number 1 Region: 462-971
Classification Level Classification E-value
Superfamily ALDH-like 1.18e-153
Family ALDH-like 0.00000000374
Further Details:      
 
Domain Number 2 Region: 118-451
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.18e-96
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42522777|ref|NP_968157.1|
Sequence length 982
Comment 1-pyrroline-5 carboxylate dehydrogenase [Bdellovibrio bacteriovorus HD100]
Sequence
MNDIQSQIVSRGEEILKRMESQSKASIFSKDFWYGSIMEWSMKNEKFKTNMFRFVDVLPS
INSGDEVARHLKEYFSEDGGTLPPVFNVGLGLGSLAPGLMAGAIKKNVMGMAKMFITGES
PDEALPVLKKARKNKMTFTVDILGEATLSEKEAQDYSNKYMELVTWLAKDAEKWDEVPQI
DRDHEGALPKVNVSVKMTALYSQIKDAAWDESKKILKDRLRPVFRLGMEKGVFVNLDMEQ
YSVKHLTLEVFTELINEPEFKNYKFFGIVIQAYLRDSFEDVKSLTEFAQKRGTPFWVRLV
KGAYWDYETIEAEQRGWPVPVYTNKAESDANYELCAKYLLENIKFIRPAFASHNVRTLAA
CMLYAEKLNIPKEALEFQMLYGMAEPIKKTIVDMGYRMREYAPVGELIPGMAYLVRRLLE
NTSNESWLRGKFADNKSMAELLKDPAQGLTPTSPVIPKKPGKFYNEPLLDFAVKADREKM
LKALAEAKASLPVNVNIVINNKELQSGKIFDRVNPSQSDQIVGKIQMATTEQAEQAMQAA
QTAYKTWKNVPCEQRAALVDKLADIMTRDRFKLIATQVLEVGKPWAEADGDIGEAIDFCR
YYARHMRELQKPLRVGGLPGELSHYIYKSRGVTAVIAPWNFPLAILAGMVTAAAVAGNTV
VMKPAEQSTVVAWGLMKMIQEAGFPQGVINFLPGYGEEVGEYIVNHKYTTTIAFTGSKAV
GLHIMNRAAVVQPGQQHVKRCIIEMGGKNAVIIDNDADLDEAVDGVIYSAFGFSGQKCSA
ASRVIVLDEVYDRFVDRLVETAKSIEIHPAENPKAYMGPVVDKEAYDRILGTIAEAEKNH
KLLFKGSVPGGGFFAPPTIFGDVPGDAKLAQAEIFGPVVAVIRAKNLDQALDIANSTEYA
LTGGVFSRSPANINRVKEELEVGNLYVNRGITGAMVDRHPFGGFKMSGIGSKTGGPDYLK
QYMEPACVTENTLRRGFAPAEE
Download sequence
Identical sequences Q6MNK1
264462.Bd1251 WP_011163752.1.10133 WP_011163752.1.54414 gi|42522777|ref|NP_968157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]