SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42523140|ref|NP_968520.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42523140|ref|NP_968520.1|
Domain Number 1 Region: 206-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.54e-70
Family B3/B4 domain of PheRS, PheT 0.00000943
Further Details:      
 
Domain Number 2 Region: 39-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.52e-43
Family Myf domain 0.0026
Further Details:      
 
Domain Number 3 Region: 471-707
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.44e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00071
Further Details:      
 
Domain Number 4 Region: 715-813
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-27
Family Anticodon-binding domain of PheRS 0.00096
Further Details:      
 
Domain Number 5 Region: 409-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000101
Family Domains B1 and B5 of PheRS-beta, PheT 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42523140|ref|NP_968520.1|
Sequence length 813
Comment phenylalanyl-tRNA synthetase beta chain [Bdellovibrio bacteriovorus HD100]
Sequence
MKISLKWLHDYVDVTEFFQKPEVLAEALTRGGLEVEEITNRAKDFNHVVIGHILEKDKHP
NADKLSLCRVSTGEGVVHQIVCGAQNHKAGDRVIVALPGAVLPGNFAIKKSAVRGVDSAG
MLCSLKELGLATESEGIAILPADAPVGKAYAEYGGYDDVTFELKVTANRADCLSHFGLAR
EVSTLFGKELKVPSSELKTNGKSSKSEIALDVKAFDLCPRYAGRFLKGVKVGPSPAWLKA
RLESVGMNSINNIVDVTNYVMLELGQPLHAFDAAFINGKKIIVDRAVAGEKFITLDGTEI
ALNGAELTIRDVNHPVCLAGVVGGKNSGVSDSTTEVFLEAAYFLPMSARKTSRSHGIDTD
SSYRFARGVDPDGTLRGLNRAAALILEVAGGEAYADHHDFYPNPVKKAPVDITIKTVSDR
LGYEAEEHKFVDFMKRLGCEINKKGETFTVLPPTFRFDIEQDMDLVEEYARLNGYEHIPE
ALPALAAAPSFQDKTFMLNRTTSELLRGEGFQQAVNFAFVGSKAQKAFLGSLEALKATGL
AATEKEIRILNPLNEEMDVMRSSLSFGLFKNLNHNFHSGNMQGRLFEIGSTFFVKDDGSF
AEGSRAGMAIWGRASNLWNKSLDYPVVYELKAAVEVLLKSLNISSYTWVTPANKSEVPEF
LHQGQFAQLLVEGKKVGFIGTLHPLLLEDNKIRVPAALAELDLDQLYKGQPRPYRIQSVS
KFPIVERDFAFVMPKALKVGDVLKDIRKAGAGLLLNVDVFDLYEGEKMEAGKKSVAIRIW
LQDKNATLQETQINETTTKILESLKKNFDLSVR
Download sequence
Identical sequences Q6MMJ1
WP_011164115.1.10133 WP_011164115.1.54414 264462.Bd1638 gi|42523140|ref|NP_968520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]