SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42524593|ref|NP_969973.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42524593|ref|NP_969973.1|
Domain Number 1 Region: 212-556
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.43e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.0000353
Further Details:      
 
Domain Number 2 Region: 45-211
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.01e-40
Family Penicillin binding protein dimerisation domain 0.0024
Further Details:      
 
Domain Number 3 Region: 607-659
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000118
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42524593|ref|NP_969973.1|
Sequence length 660
Comment cell division protein [Bdellovibrio bacteriovorus HD100]
Sequence
MKSRIVVIFVGILVLWSALAMRAAYLQFLPNDRLNALQNRQFQTKVSLPARRGAIVDSNG
RDLAMSAAAYSLYADPKLLENRKQVAKKLAKVLNQSPESVYAKIKDGNRRFVWIQRMLEQ
DKADEIKSWDIRGLSFVEEWRRVYPNETLLAQTLGFLGSEGQGLEGLELGYNQALMGNKK
KVLVKRDARGRPLINDGLMFIENPEGTELKLTVDSDLQYRLESELANAVSQFEADHAVGV
ILDAKTSKILALASAPTFDVNKAAKSPSEYRRNKIVTDAFEPGSTMKAFVIAAALRDGLI
QPNTKFYCEKGSFRVGDRIIKEAETREKFEDLTVSEILAVSSNVGTTKIAFKMGQERLRQ
GLLDFGFGQRLGVDLPGEARGMVQSLPWRQHLLSNISFGHGISTTPLQIANAFAAIANGG
VLNTPYIVQSMRDAETGELVEVQPKPIRRILSAEQAAQMRAMLVGVTTKGGTGGNARVDG
FMVAGKTGTAQKVNPNGRGYLRGAYISSFGGFIPANDPKFVIYVAVDSPRKSYYAATVAA
PVFSRIASYAVRKEGIAPLQLAEESTVNPKVRRVASEPKIVKKAEAPRAILTATELDKVT
NVETGDTVPNLMNLTTREVLRKVSGQDLKVKFVGQGTVSEVFPTAGSQVPESKEITVIMK
Download sequence
Identical sequences Q6MIE7
gi|42524593|ref|NP_969973.1| WP_011165570.1.10133 WP_011165570.1.54414 264462.Bd3213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]