SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42521803|ref|NP_967183.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42521803|ref|NP_967183.1|
Domain Number 1 Region: 196-368
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.78e-31
Family Peptidoglycan hydrolase LytM 0.012
Further Details:      
 
Weak hits

Sequence:  gi|42521803|ref|NP_967183.1|
Domain Number - Region: 25-110
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42521803|ref|NP_967183.1|
Sequence length 371
Comment M24/M37 family peptidase [Bdellovibrio bacteriovorus HD100]
Sequence
MKIAQILLVLGLSLTLGAKAANPTEVDSLAKDFEATKKKLEDAELKQRQVLSALYQLNKK
IKKIVTEKGEMSQQRAFLEVNIRNLTQKVEDLDQKSRQQRTLLAERLRAMYKLGGPSIAR
FLFSSSSSASLERNLKILGVVAARDLELIKNYSRDLKDLEAKRKTLAQRLDSMKSVEQKI
ALQEKALRKEQDLKGKLLDGIRKNKLFAINKINGLREKSLQYNIDDAGLFDLLFKPSFAD
QKGELSAPLEGVITRKFGLMKGQDHPYTLTHKGIFISAARGSNIKAVFEGRVSYVGTLPG
FGTTLIVDHGDHYYSVYSHAQEVKVNTGDEVTGSQVLAQVGEAPQDGSSGLYFEIRHFSE
PYDPQQWMKGL
Download sequence
Identical sequences Q6MRC1
264462.Bd0168 WP_011162778.1.10133 gi|42521803|ref|NP_967183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]