SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42522012|ref|NP_967392.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42522012|ref|NP_967392.1|
Domain Number 1 Region: 198-331
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 3.79e-56
Family Peptidoglycan hydrolase LytM 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42522012|ref|NP_967392.1|
Sequence length 334
Comment cell wall-binding protein associated metalloendopeptidase [Bdellovibrio bacteriovorus HD100]
Sequence
MDKKKVTLFIVSNQTGKTRKLVLSAAWLKAISFISAIVIIIFAAGLVDYFGLLLQAMENK
RLKAENAQLIKQFQVVESKVSALENSLERVKTFTTKLKLITNVDADDRITKLTMGPKPAA
GQPVEEYEPMEQRESTDVLEEQDQVFANKKPLNDQAGELANENADKDYASLVVRIDKAVK
ETQLKEQSVIDLWESLSERQSLLNSTPNMKPAKGWITSRFGYRISPFTGKTALHAGLDIA
AAPGSPVYAPADGVVVFASYDESYGKLITIDYGYGVTTRFGHLSQIYVQVGQRVNKWDVV
GAVGNTGRSTGPHLHYEVRINGTAVDPINYILDE
Download sequence
Identical sequences Q6MQR2
gi|42522012|ref|NP_967392.1| 264462.Bd0398 WP_011162987.1.10133 WP_011162987.1.54414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]