SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42525099|ref|NP_970479.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42525099|ref|NP_970479.1|
Domain Number 1 Region: 99-350
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.2e-49
Family Peptidoglycan hydrolase LytM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42525099|ref|NP_970479.1|
Sequence length 368
Comment membrane protein related to metalloendopeptidase [Bdellovibrio bacteriovorus HD100]
Sequence
MNLHLVTLVSAFLLAFTSYQSAQAGASTFTAKPVRLGDNLISILRQHGFSQSERETVVGS
NSKLRNLFLTLDTRYLVRQLKGETELRMFDSQTSDAFRIIKKAGKVQAFAYDPQYKISHT
RVEGKVYGSLLGSILAKINSNWVATRFMDAYAFDIAPRAVSRGADFWLVVERKFEQGQFV
KYGEVLQTSLDISGRPVQKKFVRNNKGGGVFFAAGDLLENKPFYAPVDYLKIASRFKPNR
VHPITKRLQPHLGIDFELPVGEPVYAPRKGTVVRYGRNHAAGNYIILLHSNGMETAYNHL
HRIDKRIRQGLRVSAGERIGEVGCTGYCTRPHLHFAVKKKGRMVDPIKYIKSYPSHMEAM
LEARVAAN
Download sequence
Identical sequences Q6MGZ5
264462.Bd3771 WP_011166076.1.10133 gi|42525099|ref|NP_970479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]