SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33591693|ref|NP_879337.1| from Bordetella pertussis Tohama I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33591693|ref|NP_879337.1|
Domain Number 1 Region: 129-280
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.58e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0066
Further Details:      
 
Domain Number 2 Region: 63-113
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family AraC type transcriptional activator 0.012
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000237
Family AraC type transcriptional activator 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33591693|ref|NP_879337.1|
Sequence length 281
Comment AraC family transcriptional regulator [Bordetella pertussis Tohama I]
Sequence
MKPKTRLYYAERLEPVLAWLAARPDADADLHRLAELACLSPYYFHRVYRALLGETVHATV
QRMRLARASVALAQGKGSLRQVADRAGYASEAAFSRAFSAQYGLPPGRYRAKRSSPFNPE
ELRMYPLTMEDFPGLSLAILAHQGDYQEIGNTFDRLALLAAIQDLVRDGMQPPPRYIGVY
YDDPAQVARDALRSRAGVSLPPGTAAPAPFEPLDIPAMRCAVLEYTGPYSEIEAPYNWLF
SQWLPASGQEPGDFPMFEEYLNDPKTTPAAQLKTRIYLPLA
Download sequence
Identical sequences A0A0A0XLN7 A0A0E7U660 A0A0N2QRU8 A0A171JUY5 Q7VSE7
257313.BP0483 gi|33591693|ref|NP_879337.1| APC20442 NP_879337.1.91861 WP_010929833.1.100022 WP_010929833.1.100434 WP_010929833.1.100555 WP_010929833.1.100619 WP_010929833.1.100675 WP_010929833.1.100759 WP_010929833.1.100989 WP_010929833.1.101082 WP_010929833.1.101128 WP_010929833.1.101132 WP_010929833.1.10115 WP_010929833.1.101264 WP_010929833.1.101372 WP_010929833.1.101703 WP_010929833.1.10189 WP_010929833.1.101955 WP_010929833.1.10527 WP_010929833.1.10899 WP_010929833.1.11100 WP_010929833.1.11718 WP_010929833.1.12242 WP_010929833.1.12615 WP_010929833.1.12628 WP_010929833.1.12642 WP_010929833.1.12812 WP_010929833.1.12848 WP_010929833.1.12960 WP_010929833.1.12961 WP_010929833.1.12998 WP_010929833.1.13010 WP_010929833.1.13337 WP_010929833.1.13387 WP_010929833.1.13571 WP_010929833.1.13878 WP_010929833.1.13976 WP_010929833.1.1435 WP_010929833.1.14857 WP_010929833.1.14969 WP_010929833.1.15153 WP_010929833.1.15298 WP_010929833.1.15595 WP_010929833.1.15680 WP_010929833.1.15694 WP_010929833.1.16132 WP_010929833.1.16456 WP_010929833.1.16646 WP_010929833.1.16872 WP_010929833.1.16901 WP_010929833.1.16953 WP_010929833.1.17083 WP_010929833.1.1750 WP_010929833.1.17872 WP_010929833.1.18020 WP_010929833.1.18291 WP_010929833.1.18525 WP_010929833.1.18595 WP_010929833.1.18642 WP_010929833.1.18982 WP_010929833.1.19155 WP_010929833.1.19208 WP_010929833.1.19242 WP_010929833.1.19511 WP_010929833.1.19550 WP_010929833.1.19657 WP_010929833.1.19676 WP_010929833.1.20036 WP_010929833.1.20365 WP_010929833.1.20392 WP_010929833.1.20462 WP_010929833.1.20642 WP_010929833.1.20675 WP_010929833.1.20734 WP_010929833.1.20770 WP_010929833.1.20917 WP_010929833.1.2111 WP_010929833.1.21238 WP_010929833.1.2161 WP_010929833.1.21624 WP_010929833.1.21880 WP_010929833.1.21917 WP_010929833.1.22017 WP_010929833.1.22232 WP_010929833.1.22423 WP_010929833.1.22487 WP_010929833.1.22593 WP_010929833.1.22705 WP_010929833.1.23079 WP_010929833.1.23183 WP_010929833.1.23214 WP_010929833.1.23368 WP_010929833.1.23599 WP_010929833.1.2372 WP_010929833.1.23851 WP_010929833.1.23951 WP_010929833.1.24160 WP_010929833.1.24171 WP_010929833.1.24320 WP_010929833.1.24505 WP_010929833.1.24682 WP_010929833.1.24749 WP_010929833.1.24761 WP_010929833.1.24819 WP_010929833.1.24942 WP_010929833.1.25162 WP_010929833.1.25335 WP_010929833.1.25395 WP_010929833.1.25725 WP_010929833.1.25784 WP_010929833.1.25806 WP_010929833.1.25823 WP_010929833.1.26275 WP_010929833.1.26501 WP_010929833.1.26519 WP_010929833.1.26991 WP_010929833.1.27198 WP_010929833.1.27788 WP_010929833.1.28030 WP_010929833.1.28495 WP_010929833.1.28615 WP_010929833.1.28748 WP_010929833.1.2876 WP_010929833.1.2883 WP_010929833.1.28911 WP_010929833.1.29446 WP_010929833.1.29460 WP_010929833.1.29496 WP_010929833.1.29534 WP_010929833.1.29639 WP_010929833.1.29721 WP_010929833.1.30048 WP_010929833.1.30085 WP_010929833.1.3025 WP_010929833.1.30325 WP_010929833.1.30804 WP_010929833.1.3146 WP_010929833.1.31517 WP_010929833.1.31640 WP_010929833.1.31875 WP_010929833.1.31881 WP_010929833.1.32044 WP_010929833.1.3209 WP_010929833.1.32390 WP_010929833.1.32490 WP_010929833.1.32619 WP_010929833.1.32640 WP_010929833.1.32662 WP_010929833.1.32669 WP_010929833.1.32673 WP_010929833.1.32732 WP_010929833.1.32787 WP_010929833.1.3326 WP_010929833.1.33272 WP_010929833.1.33320 WP_010929833.1.33342 WP_010929833.1.33489 WP_010929833.1.33785 WP_010929833.1.33904 WP_010929833.1.33992 WP_010929833.1.34216 WP_010929833.1.34487 WP_010929833.1.3449 WP_010929833.1.34660 WP_010929833.1.34761 WP_010929833.1.34880 WP_010929833.1.34936 WP_010929833.1.35228 WP_010929833.1.35282 WP_010929833.1.35457 WP_010929833.1.35734 WP_010929833.1.35894 WP_010929833.1.36280 WP_010929833.1.36572 WP_010929833.1.37410 WP_010929833.1.37431 WP_010929833.1.37631 WP_010929833.1.37705 WP_010929833.1.37780 WP_010929833.1.3800 WP_010929833.1.38046 WP_010929833.1.38178 WP_010929833.1.38328 WP_010929833.1.38923 WP_010929833.1.39109 WP_010929833.1.39143 WP_010929833.1.39323 WP_010929833.1.39544 WP_010929833.1.40067 WP_010929833.1.40089 WP_010929833.1.40139 WP_010929833.1.40287 WP_010929833.1.40381 WP_010929833.1.40521 WP_010929833.1.40671 WP_010929833.1.40699 WP_010929833.1.40717 WP_010929833.1.40885 WP_010929833.1.40905 WP_010929833.1.40936 WP_010929833.1.41152 WP_010929833.1.41181 WP_010929833.1.41295 WP_010929833.1.41354 WP_010929833.1.4140 WP_010929833.1.41420 WP_010929833.1.41565 WP_010929833.1.42055 WP_010929833.1.4233 WP_010929833.1.42334 WP_010929833.1.42416 WP_010929833.1.42497 WP_010929833.1.4318 WP_010929833.1.43230 WP_010929833.1.43238 WP_010929833.1.43282 WP_010929833.1.43291 WP_010929833.1.43401 WP_010929833.1.43734 WP_010929833.1.44190 WP_010929833.1.44232 WP_010929833.1.44259 WP_010929833.1.44349 WP_010929833.1.44451 WP_010929833.1.44576 WP_010929833.1.44662 WP_010929833.1.44958 WP_010929833.1.45070 WP_010929833.1.45311 WP_010929833.1.46219 WP_010929833.1.4628 WP_010929833.1.46321 WP_010929833.1.46447 WP_010929833.1.46719 WP_010929833.1.46778 WP_010929833.1.46785 WP_010929833.1.47512 WP_010929833.1.47517 WP_010929833.1.47818 WP_010929833.1.47874 WP_010929833.1.48179 WP_010929833.1.48301 WP_010929833.1.48344 WP_010929833.1.48641 WP_010929833.1.49081 WP_010929833.1.49649 WP_010929833.1.49980 WP_010929833.1.50490 WP_010929833.1.50707 WP_010929833.1.51064 WP_010929833.1.5120 WP_010929833.1.51286 WP_010929833.1.51344 WP_010929833.1.51362 WP_010929833.1.51769 WP_010929833.1.51879 WP_010929833.1.52025 WP_010929833.1.52065 WP_010929833.1.5222 WP_010929833.1.5240 WP_010929833.1.52986 WP_010929833.1.53067 WP_010929833.1.53156 WP_010929833.1.53271 WP_010929833.1.53477 WP_010929833.1.53604 WP_010929833.1.53618 WP_010929833.1.53654 WP_010929833.1.53658 WP_010929833.1.53791 WP_010929833.1.5380 WP_010929833.1.53816 WP_010929833.1.54042 WP_010929833.1.54106 WP_010929833.1.54204 WP_010929833.1.54460 WP_010929833.1.5457 WP_010929833.1.54632 WP_010929833.1.54710 WP_010929833.1.54734 WP_010929833.1.54904 WP_010929833.1.55255 WP_010929833.1.5531 WP_010929833.1.55350 WP_010929833.1.56056 WP_010929833.1.56084 WP_010929833.1.56254 WP_010929833.1.56330 WP_010929833.1.56421 WP_010929833.1.56752 WP_010929833.1.56892 WP_010929833.1.57082 WP_010929833.1.5712 WP_010929833.1.57383 WP_010929833.1.57552 WP_010929833.1.57713 WP_010929833.1.57806 WP_010929833.1.5837 WP_010929833.1.58529 WP_010929833.1.58577 WP_010929833.1.58765 WP_010929833.1.58806 WP_010929833.1.58896 WP_010929833.1.58923 WP_010929833.1.58964 WP_010929833.1.59089 WP_010929833.1.59128 WP_010929833.1.59319 WP_010929833.1.60003 WP_010929833.1.6039 WP_010929833.1.60428 WP_010929833.1.60747 WP_010929833.1.60780 WP_010929833.1.60837 WP_010929833.1.60856 WP_010929833.1.61051 WP_010929833.1.61242 WP_010929833.1.62052 WP_010929833.1.6229 WP_010929833.1.62500 WP_010929833.1.62599 WP_010929833.1.62940 WP_010929833.1.62965 WP_010929833.1.63049 WP_010929833.1.63205 WP_010929833.1.63640 WP_010929833.1.63728 WP_010929833.1.63754 WP_010929833.1.63948 WP_010929833.1.64270 WP_010929833.1.64318 WP_010929833.1.64375 WP_010929833.1.64451 WP_010929833.1.6471 WP_010929833.1.64999 WP_010929833.1.65148 WP_010929833.1.65861 WP_010929833.1.65865 WP_010929833.1.66032 WP_010929833.1.66036 WP_010929833.1.66098 WP_010929833.1.66583 WP_010929833.1.66618 WP_010929833.1.66638 WP_010929833.1.66798 WP_010929833.1.67435 WP_010929833.1.67535 WP_010929833.1.67743 WP_010929833.1.67933 WP_010929833.1.6801 WP_010929833.1.68280 WP_010929833.1.68311 WP_010929833.1.68338 WP_010929833.1.68516 WP_010929833.1.68884 WP_010929833.1.69041 WP_010929833.1.6922 WP_010929833.1.69494 WP_010929833.1.69590 WP_010929833.1.69618 WP_010929833.1.69751 WP_010929833.1.69885 WP_010929833.1.69935 WP_010929833.1.69949 WP_010929833.1.70145 WP_010929833.1.70388 WP_010929833.1.70426 WP_010929833.1.70575 WP_010929833.1.70715 WP_010929833.1.70740 WP_010929833.1.70854 WP_010929833.1.70866 WP_010929833.1.70972 WP_010929833.1.71157 WP_010929833.1.71181 WP_010929833.1.71349 WP_010929833.1.71506 WP_010929833.1.71774 WP_010929833.1.71889 WP_010929833.1.71963 WP_010929833.1.72076 WP_010929833.1.72213 WP_010929833.1.72312 WP_010929833.1.72409 WP_010929833.1.72456 WP_010929833.1.72670 WP_010929833.1.72737 WP_010929833.1.72849 WP_010929833.1.73143 WP_010929833.1.73290 WP_010929833.1.73474 WP_010929833.1.73787 WP_010929833.1.74018 WP_010929833.1.74166 WP_010929833.1.74203 WP_010929833.1.74209 WP_010929833.1.74467 WP_010929833.1.74492 WP_010929833.1.74613 WP_010929833.1.74634 WP_010929833.1.74903 WP_010929833.1.75340 WP_010929833.1.75646 WP_010929833.1.75754 WP_010929833.1.76046 WP_010929833.1.76310 WP_010929833.1.76380 WP_010929833.1.76506 WP_010929833.1.76527 WP_010929833.1.76691 WP_010929833.1.76901 WP_010929833.1.76950 WP_010929833.1.76959 WP_010929833.1.7758 WP_010929833.1.77597 WP_010929833.1.78299 WP_010929833.1.78490 WP_010929833.1.78627 WP_010929833.1.78721 WP_010929833.1.78958 WP_010929833.1.79121 WP_010929833.1.79194 WP_010929833.1.79301 WP_010929833.1.79623 WP_010929833.1.79624 WP_010929833.1.79643 WP_010929833.1.79978 WP_010929833.1.80271 WP_010929833.1.8033 WP_010929833.1.80800 WP_010929833.1.80838 WP_010929833.1.80851 WP_010929833.1.81051 WP_010929833.1.81135 WP_010929833.1.81411 WP_010929833.1.81501 WP_010929833.1.81757 WP_010929833.1.82018 WP_010929833.1.82054 WP_010929833.1.8207 WP_010929833.1.82146 WP_010929833.1.82152 WP_010929833.1.82356 WP_010929833.1.82364 WP_010929833.1.82559 WP_010929833.1.82588 WP_010929833.1.82632 WP_010929833.1.82713 WP_010929833.1.82734 WP_010929833.1.82751 WP_010929833.1.82940 WP_010929833.1.82972 WP_010929833.1.83190 WP_010929833.1.83298 WP_010929833.1.83392 WP_010929833.1.83406 WP_010929833.1.83428 WP_010929833.1.83507 WP_010929833.1.83509 WP_010929833.1.83669 WP_010929833.1.8381 WP_010929833.1.84043 WP_010929833.1.84078 WP_010929833.1.84114 WP_010929833.1.84624 WP_010929833.1.84856 WP_010929833.1.84859 WP_010929833.1.85121 WP_010929833.1.85139 WP_010929833.1.854 WP_010929833.1.85499 WP_010929833.1.85839 WP_010929833.1.86167 WP_010929833.1.86301 WP_010929833.1.86388 WP_010929833.1.86428 WP_010929833.1.86480 WP_010929833.1.86642 WP_010929833.1.87159 WP_010929833.1.87233 WP_010929833.1.87469 WP_010929833.1.87992 WP_010929833.1.8802 WP_010929833.1.88160 WP_010929833.1.88310 WP_010929833.1.88486 WP_010929833.1.88494 WP_010929833.1.88901 WP_010929833.1.88921 WP_010929833.1.89075 WP_010929833.1.89192 WP_010929833.1.89488 WP_010929833.1.89642 WP_010929833.1.89947 WP_010929833.1.90523 WP_010929833.1.90858 WP_010929833.1.91105 WP_010929833.1.91309 WP_010929833.1.91439 WP_010929833.1.91845 WP_010929833.1.91932 WP_010929833.1.91988 WP_010929833.1.92256 WP_010929833.1.92285 WP_010929833.1.92528 WP_010929833.1.92942 WP_010929833.1.93268 WP_010929833.1.9334 WP_010929833.1.93362 WP_010929833.1.9367 WP_010929833.1.93807 WP_010929833.1.93850 WP_010929833.1.93966 WP_010929833.1.94019 WP_010929833.1.94250 WP_010929833.1.94266 WP_010929833.1.94283 WP_010929833.1.94386 WP_010929833.1.94521 WP_010929833.1.94524 WP_010929833.1.9476 WP_010929833.1.94832 WP_010929833.1.95061 WP_010929833.1.95166 WP_010929833.1.95221 WP_010929833.1.95421 WP_010929833.1.95487 WP_010929833.1.95504 WP_010929833.1.95591 WP_010929833.1.95608 WP_010929833.1.95637 WP_010929833.1.95694 WP_010929833.1.95814 WP_010929833.1.96102 WP_010929833.1.96130 WP_010929833.1.96199 WP_010929833.1.96241 WP_010929833.1.96400 WP_010929833.1.96719 WP_010929833.1.9688 WP_010929833.1.969 WP_010929833.1.97215 WP_010929833.1.97275 WP_010929833.1.9744 WP_010929833.1.97750 WP_010929833.1.97985 WP_010929833.1.98081 WP_010929833.1.98149 WP_010929833.1.9825 WP_010929833.1.98258 WP_010929833.1.98303 WP_010929833.1.98580 WP_010929833.1.98669 WP_010929833.1.98995 WP_010929833.1.99135 WP_010929833.1.99254 WP_010929833.1.99261 WP_010929833.1.99407 WP_010929833.1.99607 WP_010929833.1.99644 WP_010929833.1.9977 WP_010929833.1.99857 WP_010929833.1.99971 gi|384202998|ref|YP_005588737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]