SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33592176|ref|NP_879820.1| from Bordetella pertussis Tohama I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33592176|ref|NP_879820.1|
Domain Number 1 Region: 156-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-71
Family Methylesterase CheB, C-terminal domain 0.000000182
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.57e-28
Family CheY-related 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33592176|ref|NP_879820.1|
Sequence length 350
Comment chemotaxis-specific methylesterase [Bordetella pertussis Tohama I]
Sequence
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRALAPASHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMLAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERILTRLGDRGHRV
Download sequence
Identical sequences A0A0A0XF40 A0A0N2QQ19 A0A0U1RNC4 A0A140KVH7 A0A171K0T6 Q7VZ94
NP_879820.1.91861 WP_010930146.1.100022 WP_010930146.1.100434 WP_010930146.1.100555 WP_010930146.1.100619 WP_010930146.1.100675 WP_010930146.1.100759 WP_010930146.1.100989 WP_010930146.1.101082 WP_010930146.1.101128 WP_010930146.1.101132 WP_010930146.1.10115 WP_010930146.1.101264 WP_010930146.1.101372 WP_010930146.1.10149 WP_010930146.1.101703 WP_010930146.1.10189 WP_010930146.1.101955 WP_010930146.1.10527 WP_010930146.1.10899 WP_010930146.1.11100 WP_010930146.1.11718 WP_010930146.1.12242 WP_010930146.1.12615 WP_010930146.1.12628 WP_010930146.1.12642 WP_010930146.1.12812 WP_010930146.1.12848 WP_010930146.1.12961 WP_010930146.1.12998 WP_010930146.1.13010 WP_010930146.1.13337 WP_010930146.1.13387 WP_010930146.1.13571 WP_010930146.1.13878 WP_010930146.1.13976 WP_010930146.1.1435 WP_010930146.1.14857 WP_010930146.1.14969 WP_010930146.1.15153 WP_010930146.1.15298 WP_010930146.1.15595 WP_010930146.1.15680 WP_010930146.1.15694 WP_010930146.1.16132 WP_010930146.1.16456 WP_010930146.1.16646 WP_010930146.1.16872 WP_010930146.1.16901 WP_010930146.1.16953 WP_010930146.1.17083 WP_010930146.1.1750 WP_010930146.1.17872 WP_010930146.1.18020 WP_010930146.1.18291 WP_010930146.1.18525 WP_010930146.1.18595 WP_010930146.1.18642 WP_010930146.1.18982 WP_010930146.1.19155 WP_010930146.1.19208 WP_010930146.1.19242 WP_010930146.1.19511 WP_010930146.1.19550 WP_010930146.1.19657 WP_010930146.1.19676 WP_010930146.1.20036 WP_010930146.1.20365 WP_010930146.1.20392 WP_010930146.1.20462 WP_010930146.1.20642 WP_010930146.1.20675 WP_010930146.1.20734 WP_010930146.1.20770 WP_010930146.1.20917 WP_010930146.1.2111 WP_010930146.1.21238 WP_010930146.1.21550 WP_010930146.1.21624 WP_010930146.1.21880 WP_010930146.1.21917 WP_010930146.1.22017 WP_010930146.1.22232 WP_010930146.1.22312 WP_010930146.1.22423 WP_010930146.1.22487 WP_010930146.1.22593 WP_010930146.1.22705 WP_010930146.1.23079 WP_010930146.1.23183 WP_010930146.1.23214 WP_010930146.1.23368 WP_010930146.1.23599 WP_010930146.1.2372 WP_010930146.1.23851 WP_010930146.1.23951 WP_010930146.1.24171 WP_010930146.1.24320 WP_010930146.1.24505 WP_010930146.1.24682 WP_010930146.1.24749 WP_010930146.1.24761 WP_010930146.1.24819 WP_010930146.1.24942 WP_010930146.1.25162 WP_010930146.1.25335 WP_010930146.1.25395 WP_010930146.1.25725 WP_010930146.1.25784 WP_010930146.1.25823 WP_010930146.1.26275 WP_010930146.1.26501 WP_010930146.1.26519 WP_010930146.1.26991 WP_010930146.1.27198 WP_010930146.1.27788 WP_010930146.1.28030 WP_010930146.1.28495 WP_010930146.1.28615 WP_010930146.1.28748 WP_010930146.1.2876 WP_010930146.1.2883 WP_010930146.1.28911 WP_010930146.1.2925 WP_010930146.1.29446 WP_010930146.1.29460 WP_010930146.1.29496 WP_010930146.1.29534 WP_010930146.1.29639 WP_010930146.1.29721 WP_010930146.1.30085 WP_010930146.1.3025 WP_010930146.1.30325 WP_010930146.1.30804 WP_010930146.1.3146 WP_010930146.1.31517 WP_010930146.1.31640 WP_010930146.1.31875 WP_010930146.1.32044 WP_010930146.1.3209 WP_010930146.1.32390 WP_010930146.1.32490 WP_010930146.1.32640 WP_010930146.1.32662 WP_010930146.1.32669 WP_010930146.1.32673 WP_010930146.1.32732 WP_010930146.1.32787 WP_010930146.1.3326 WP_010930146.1.33272 WP_010930146.1.33320 WP_010930146.1.33342 WP_010930146.1.33489 WP_010930146.1.33785 WP_010930146.1.33904 WP_010930146.1.33992 WP_010930146.1.34216 WP_010930146.1.34487 WP_010930146.1.34761 WP_010930146.1.34880 WP_010930146.1.34936 WP_010930146.1.35282 WP_010930146.1.35457 WP_010930146.1.35734 WP_010930146.1.35819 WP_010930146.1.35894 WP_010930146.1.36280 WP_010930146.1.36572 WP_010930146.1.37410 WP_010930146.1.37431 WP_010930146.1.37631 WP_010930146.1.37705 WP_010930146.1.37780 WP_010930146.1.3800 WP_010930146.1.38046 WP_010930146.1.38178 WP_010930146.1.38328 WP_010930146.1.38923 WP_010930146.1.39109 WP_010930146.1.39143 WP_010930146.1.39323 WP_010930146.1.39544 WP_010930146.1.39649 WP_010930146.1.40089 WP_010930146.1.40139 WP_010930146.1.40287 WP_010930146.1.40381 WP_010930146.1.40521 WP_010930146.1.40699 WP_010930146.1.40717 WP_010930146.1.40885 WP_010930146.1.40905 WP_010930146.1.40936 WP_010930146.1.41181 WP_010930146.1.41295 WP_010930146.1.41354 WP_010930146.1.4140 WP_010930146.1.41420 WP_010930146.1.41565 WP_010930146.1.42055 WP_010930146.1.4233 WP_010930146.1.42334 WP_010930146.1.42416 WP_010930146.1.42497 WP_010930146.1.43230 WP_010930146.1.43238 WP_010930146.1.43282 WP_010930146.1.43291 WP_010930146.1.43401 WP_010930146.1.43734 WP_010930146.1.44190 WP_010930146.1.44232 WP_010930146.1.44259 WP_010930146.1.44349 WP_010930146.1.44451 WP_010930146.1.44576 WP_010930146.1.44662 WP_010930146.1.44958 WP_010930146.1.45070 WP_010930146.1.45311 WP_010930146.1.46219 WP_010930146.1.4628 WP_010930146.1.46321 WP_010930146.1.46447 WP_010930146.1.46719 WP_010930146.1.46785 WP_010930146.1.47512 WP_010930146.1.47517 WP_010930146.1.47818 WP_010930146.1.47874 WP_010930146.1.48179 WP_010930146.1.48301 WP_010930146.1.48344 WP_010930146.1.48641 WP_010930146.1.49081 WP_010930146.1.49649 WP_010930146.1.49980 WP_010930146.1.50490 WP_010930146.1.50707 WP_010930146.1.51064 WP_010930146.1.5120 WP_010930146.1.51286 WP_010930146.1.51362 WP_010930146.1.51769 WP_010930146.1.51879 WP_010930146.1.52025 WP_010930146.1.52065 WP_010930146.1.5222 WP_010930146.1.5240 WP_010930146.1.5290 WP_010930146.1.52986 WP_010930146.1.53067 WP_010930146.1.53156 WP_010930146.1.53271 WP_010930146.1.53477 WP_010930146.1.53618 WP_010930146.1.53654 WP_010930146.1.53791 WP_010930146.1.5380 WP_010930146.1.54042 WP_010930146.1.54106 WP_010930146.1.54204 WP_010930146.1.54460 WP_010930146.1.5457 WP_010930146.1.54632 WP_010930146.1.54710 WP_010930146.1.54734 WP_010930146.1.54904 WP_010930146.1.55255 WP_010930146.1.5531 WP_010930146.1.55350 WP_010930146.1.56056 WP_010930146.1.56084 WP_010930146.1.56254 WP_010930146.1.56330 WP_010930146.1.56421 WP_010930146.1.56752 WP_010930146.1.56892 WP_010930146.1.57082 WP_010930146.1.5712 WP_010930146.1.57383 WP_010930146.1.57552 WP_010930146.1.57713 WP_010930146.1.5837 WP_010930146.1.58529 WP_010930146.1.58577 WP_010930146.1.58765 WP_010930146.1.58806 WP_010930146.1.58896 WP_010930146.1.58923 WP_010930146.1.58964 WP_010930146.1.59089 WP_010930146.1.59128 WP_010930146.1.59319 WP_010930146.1.60003 WP_010930146.1.6039 WP_010930146.1.60428 WP_010930146.1.60747 WP_010930146.1.60780 WP_010930146.1.60837 WP_010930146.1.60856 WP_010930146.1.61051 WP_010930146.1.61242 WP_010930146.1.62052 WP_010930146.1.6229 WP_010930146.1.62599 WP_010930146.1.62940 WP_010930146.1.62965 WP_010930146.1.63205 WP_010930146.1.63640 WP_010930146.1.63728 WP_010930146.1.63754 WP_010930146.1.63948 WP_010930146.1.64270 WP_010930146.1.64318 WP_010930146.1.64375 WP_010930146.1.64451 WP_010930146.1.6471 WP_010930146.1.64999 WP_010930146.1.65148 WP_010930146.1.65861 WP_010930146.1.65865 WP_010930146.1.66032 WP_010930146.1.66036 WP_010930146.1.66098 WP_010930146.1.66618 WP_010930146.1.66638 WP_010930146.1.66798 WP_010930146.1.67435 WP_010930146.1.67535 WP_010930146.1.67743 WP_010930146.1.67933 WP_010930146.1.6801 WP_010930146.1.68280 WP_010930146.1.68311 WP_010930146.1.68338 WP_010930146.1.68516 WP_010930146.1.68884 WP_010930146.1.69041 WP_010930146.1.6922 WP_010930146.1.69494 WP_010930146.1.69590 WP_010930146.1.69618 WP_010930146.1.69751 WP_010930146.1.69885 WP_010930146.1.69935 WP_010930146.1.69949 WP_010930146.1.70145 WP_010930146.1.70388 WP_010930146.1.70426 WP_010930146.1.70575 WP_010930146.1.70715 WP_010930146.1.70740 WP_010930146.1.70854 WP_010930146.1.70866 WP_010930146.1.70972 WP_010930146.1.71157 WP_010930146.1.71181 WP_010930146.1.71349 WP_010930146.1.71506 WP_010930146.1.71774 WP_010930146.1.71889 WP_010930146.1.71963 WP_010930146.1.72076 WP_010930146.1.7212 WP_010930146.1.72213 WP_010930146.1.72312 WP_010930146.1.72409 WP_010930146.1.72456 WP_010930146.1.72670 WP_010930146.1.72737 WP_010930146.1.72849 WP_010930146.1.73143 WP_010930146.1.73474 WP_010930146.1.74018 WP_010930146.1.74166 WP_010930146.1.74203 WP_010930146.1.74209 WP_010930146.1.74467 WP_010930146.1.74492 WP_010930146.1.74613 WP_010930146.1.74903 WP_010930146.1.75340 WP_010930146.1.75646 WP_010930146.1.75754 WP_010930146.1.76046 WP_010930146.1.76310 WP_010930146.1.76380 WP_010930146.1.76506 WP_010930146.1.76527 WP_010930146.1.76691 WP_010930146.1.76901 WP_010930146.1.76959 WP_010930146.1.7758 WP_010930146.1.77597 WP_010930146.1.78299 WP_010930146.1.78490 WP_010930146.1.78627 WP_010930146.1.78721 WP_010930146.1.78958 WP_010930146.1.79121 WP_010930146.1.79194 WP_010930146.1.79301 WP_010930146.1.79623 WP_010930146.1.79624 WP_010930146.1.79643 WP_010930146.1.8033 WP_010930146.1.80800 WP_010930146.1.80838 WP_010930146.1.80851 WP_010930146.1.81051 WP_010930146.1.81135 WP_010930146.1.81411 WP_010930146.1.81501 WP_010930146.1.82018 WP_010930146.1.82054 WP_010930146.1.8207 WP_010930146.1.82146 WP_010930146.1.82152 WP_010930146.1.82356 WP_010930146.1.82364 WP_010930146.1.82559 WP_010930146.1.82632 WP_010930146.1.82713 WP_010930146.1.82734 WP_010930146.1.82751 WP_010930146.1.82940 WP_010930146.1.82972 WP_010930146.1.83190 WP_010930146.1.83298 WP_010930146.1.83392 WP_010930146.1.83406 WP_010930146.1.83428 WP_010930146.1.83507 WP_010930146.1.83509 WP_010930146.1.83669 WP_010930146.1.8381 WP_010930146.1.84043 WP_010930146.1.84078 WP_010930146.1.84114 WP_010930146.1.84624 WP_010930146.1.84856 WP_010930146.1.84859 WP_010930146.1.85121 WP_010930146.1.85139 WP_010930146.1.854 WP_010930146.1.85499 WP_010930146.1.85839 WP_010930146.1.86167 WP_010930146.1.86301 WP_010930146.1.86388 WP_010930146.1.86428 WP_010930146.1.86480 WP_010930146.1.86642 WP_010930146.1.87159 WP_010930146.1.87233 WP_010930146.1.87469 WP_010930146.1.8802 WP_010930146.1.88160 WP_010930146.1.88310 WP_010930146.1.88486 WP_010930146.1.88494 WP_010930146.1.88901 WP_010930146.1.88921 WP_010930146.1.89075 WP_010930146.1.89192 WP_010930146.1.89488 WP_010930146.1.89642 WP_010930146.1.90523 WP_010930146.1.90858 WP_010930146.1.91105 WP_010930146.1.91439 WP_010930146.1.91932 WP_010930146.1.91988 WP_010930146.1.92285 WP_010930146.1.92528 WP_010930146.1.92942 WP_010930146.1.93268 WP_010930146.1.9334 WP_010930146.1.93362 WP_010930146.1.9367 WP_010930146.1.93807 WP_010930146.1.93850 WP_010930146.1.93966 WP_010930146.1.94019 WP_010930146.1.94250 WP_010930146.1.94266 WP_010930146.1.94283 WP_010930146.1.94386 WP_010930146.1.94521 WP_010930146.1.94524 WP_010930146.1.9476 WP_010930146.1.94832 WP_010930146.1.95061 WP_010930146.1.95166 WP_010930146.1.95221 WP_010930146.1.95421 WP_010930146.1.95487 WP_010930146.1.95504 WP_010930146.1.95591 WP_010930146.1.95608 WP_010930146.1.95637 WP_010930146.1.95694 WP_010930146.1.95814 WP_010930146.1.96102 WP_010930146.1.96130 WP_010930146.1.96199 WP_010930146.1.96241 WP_010930146.1.96400 WP_010930146.1.96719 WP_010930146.1.9688 WP_010930146.1.969 WP_010930146.1.97215 WP_010930146.1.97275 WP_010930146.1.9744 WP_010930146.1.97985 WP_010930146.1.98081 WP_010930146.1.98149 WP_010930146.1.9825 WP_010930146.1.98258 WP_010930146.1.98303 WP_010930146.1.98580 WP_010930146.1.98669 WP_010930146.1.98995 WP_010930146.1.99254 WP_010930146.1.99261 WP_010930146.1.99407 WP_010930146.1.99607 WP_010930146.1.99644 WP_010930146.1.9977 WP_010930146.1.99857 WP_010930146.1.99971 gi|384203478|ref|YP_005589217.1| gi|408415381|ref|YP_006626088.1| gi|33592176|ref|NP_879820.1| 257313.BP1032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]