SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33593072|ref|NP_880716.1| from Bordetella pertussis Tohama I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33593072|ref|NP_880716.1|
Domain Number 1 Region: 455-567
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33593072|ref|NP_880716.1|
Sequence length 601
Comment sulfate transporter [Bordetella pertussis Tohama I]
Sequence
MGKTVRGGAAAILGCWVNDITPGTLRADAQAGLLGALLVLPQGVAFAMLAGLPPEYGLYS
AIVPCIVAALFGSSRHVLSGPTNANSLALFAVLAPLALPGSPGYIQMALAVTILVGVMQL
AVGLLRLGSLANFISPSALFGFTSGAALLIAVHALKDALGLEGVQAHSAGAVLAAVGSRL
GEAHWGASVVALTTIIVTLLVRHWDRRKPHMLAGLAAGTLLAAALNAGVFTAAGQPISVL
GGLAQPWPPFHVPAVQWSVLPDLVGVAVPLTIVALAQSISIAKAVAMRSGQLIDANREFI
GQGLSNVVGGLFSSYLSCGSLNRSVPNYEAGARTPMAAVFAALLLVLLVLVSSPVLALIP
HAAIAGLLIVVAWSLLDLPRWRVLVRIAPREALIAAATLAATVTIRMEIAILLGTLLSLT
AYLYRTARPAMRPMGFDAADPQRHFAVLEGQPGELPECPQLKLLRMEGSVYFGAATHVTD
RLQALRAGASAGQRHLLVMSKSMNFIDHAGAQVWEEELRRRRAGGGDLYFHRPRPEVLRD
WRRSGFIDRLGADHIFPDKATAIHTIYERLDPEICRGCTARIFTECGPPGTAHQPGAERA
E
Download sequence
Identical sequences A0A0A0XGL9 A0A131IFL7 A0A171K4A2 Q7VWY3
gi|33593072|ref|NP_880716.1| gi|384204370|ref|YP_005590109.1| 257313.BP2049 NP_880716.1.91861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]