SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22019938m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22019938m.p
Domain Number 1 Region: 329-459
Classification Level Classification E-value
Superfamily Plus3-like 2.35e-44
Family Plus3 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22019938m.p
Sequence length 700
Sequence
MSKRKIVIESDSDSDSDDNFDEQLKLLGKRKRTDSEASAPAAPQAGGEDNESSATSESDD
EWTMDGKSSAGKKKTKAAKKNNRKSVAISSESEDPSEKSASEPEEGEVSDSDHNSSEVSD
SESDDKFFDGYDEDLIGDDEDRKRLEQMTEKEREQELYNRSERRAVLKTRFEIEKKLRQA
KKKDQKGKKKSSSDSSSRQVATPSQRSKERRKNIEDKRDSKMSAFKNLKARREEKKTKEI
AIKEQQKKKLAGNHIYSDDDDDDDDDDDDDDAPDNNSKDESSRKSDREEKSKKADTSSSS
DSSDDRSSASSDSDSDGSPKSRKKSTVYATREDLSKIRLSRNKMERWCHMPFFKNTVMGC
FVRIGIGNHEGRAIYRVAEIIDVVETLKIYQLGSARTNKGVRLRHGSAERVYRLEFVSNQ
DFTESEFFKWKEAMAHAGMTLPTRDEVEKKISDINNAFNYKFKDNDIEEIVAEKQKFKKN
PHNYAMRKTLLMKQRDQAEVEGQKDKAKDLNKQIEELEERATELDRRRTSNINSISYINQ
RNRERNMIEAEKAAIVEGEAARKAEADPFTRRACRPSLVTKVRDPEISSIIKAKVAEVKA
AEEKKKRESEANGGEAAVESKQNPVPVDKDKDKPDVKNVPERRDSEDLYAVHDFDIKIDL
EVPMSGSSIVAYNRTAQPVKEVTPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences A0A0L8H9E2
XP_014774459.1.24776 Ocbimv22019938m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]