SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22020623m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22020623m.p
Domain Number 1 Region: 1646-1950
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 7.06e-102
Family Hemocyanin middle domain 0.0000000401
Further Details:      
 
Domain Number 2 Region: 396-698
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.8e-95
Family Hemocyanin middle domain 0.000000281
Further Details:      
 
Domain Number 3 Region: 810-1111
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 4.58e-95
Family Hemocyanin middle domain 0.000000242
Further Details:      
 
Domain Number 4 Region: 1231-1521
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.96e-90
Family Hemocyanin middle domain 0.000000355
Further Details:      
 
Domain Number 5 Region: 1-272
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 7.19e-81
Family Hemocyanin middle domain 0.0000011
Further Details:      
 
Domain Number 6 Region: 2063-2275
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 9.32e-71
Family Hemocyanin middle domain 0.00000445
Further Details:      
 
Domain Number 7 Region: 1526-1630
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 1.07e-34
Family C-terminal domain of mollusc hemocyanin 0.00018
Further Details:      
 
Domain Number 8 Region: 1953-2052
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 5.1e-33
Family C-terminal domain of mollusc hemocyanin 0.0002
Further Details:      
 
Domain Number 9 Region: 274-380
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 3.4e-32
Family C-terminal domain of mollusc hemocyanin 0.00041
Further Details:      
 
Domain Number 10 Region: 701-800
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 1.83e-29
Family C-terminal domain of mollusc hemocyanin 0.00029
Further Details:      
 
Domain Number 11 Region: 1114-1214
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 2.35e-27
Family C-terminal domain of mollusc hemocyanin 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22020623m.p
Sequence length 2275
Sequence
MQKDEGPTGFQAISAYHGEPADCKAADGSTVVCCLHGMPTFPLWHRLYLVHFEQAMATHG
STHGVPYWDWTQPISELPALVQHPLFIDPSGKKAKKNVFYSGAIGFEKKVTARAVDDHLF
DASHAKKNSLLKNILMAFEQEEYCRFEVQFEIAHNPVHFLVGGRYPYSMSSLEYTSYDPL
FFLHHSNVERLFTIWQALQKHRGHDSKINCGLNLLHTPMEPFGRDSNPIELTKKNAKAAD
IFTADHLEYNYDDLTLNGMSISELDSLLKERQSHPRSFANFRLGGIKTSANVHISVCIPS
KDSRKSDDCHHDAGEFFILGGKREMPWDFGYPYLHDITDTVKSLGLELDGNYYLKAEVTA
INGSHLPSDVIPKPIVTYIPEVGHHDPEMIKVDKADVKVRKDVSVLTKEEEYGVRIAMER
FMLDKSINGYQALAEFHGLPAKCPRPDAPNRIACCEHGMATFPHWHRLVIMQFEDALADR
GSTVGVPYWDWSKPITHLPSLVAEETYQDPFTLETKPNPFFRASIDFLHSGVYTTRDIDP
RLMKQPAKGDHCPLYDGLLLAYEQDEYCDFEVQFEVTHNFVHAWIGGKEAYSMSSLHYTS
FDPLFWLHHAQVDRLWAIWQALQIHRGKPYKAYCANSEVHRPLKPFAFESPFNNNEHTRA
HAIPTDVYDYQANLGYTFDSLSFGGMSIRELQKHIDEKKTHDRVFAGFLFEGIKTSANID
LYVVAAGNEYLAAPTSVLGGSKEMPWRFDRLFRQEITDSLKALGVDPFGDFTLRVDIKDV
NGTALPSTIISQPIVIFEPGKVKTDVKFDENFRTRKAVSTLTASQMTALREALVKYEADK
TASGYQQVAAFHGSTEWCPSPDAEHKYACCHHGMATFPHWHRLLTLNFENGLRRNGYDGG
IPYWDWLNPISALPNLVAEEEYTDVNGENHINPFFSGSIDHIGKTTSRAPSADLFIQPKF
GEFTSLTNEVIFALEQEDFCSFEVQFEIAHNHIHALVGGTEPYSMSSLEFTAYDPIFLLH
HSNVDRIWAIWQALQKHRGNTYNSANCAIELLRQPMSPFSLSSDINVDSQTREHSVPFDA
FDYTKGFHYEYDSLDVSGLSIPQLQTEINKRRAKDRIFVTFLLEGHKQSLLVEYYIRLHG
SADRNKAGEFYVLGSQNEMPWKFDRVYKADITRQMEQLHLHYNDLYHIEYTLKDMSGAEV
TSLGLEPAVIFEPGLGHYGEDRAWIEPVTSANRIRKNLENLDVGEIESLRNAFKQIKMDG
TYGRIAAFHGLPAKCPNEDGSKVYTCCLHGMPNFLHWHRLYTVSVENELLARGSSVAVPY
WDWLKSFEELPKLISEATFYNSRTLHIESNPFFKGKISFENTETDRDPQPDLFGNNYFYD
HALFAFEQTDFCEFSTHLEVLHNSLHSWLGGRDPHSMSSLDYAAYDPAFFLHHSNIDRLW
AIWQELQRYRKLPYNSANCALGLLNQPMRPFSNKTANSNLLTFTHSRANDVFDYQNVFHY
KYDSLTFNGLTVIQLENLLQHNRNQQDRVFVGFLLHGVKASADVRIYICAPTGQNQENCA
NYAGVFSILGGESEMPWRFTNLFRYEITDSLVKLGLNHNSHFHIKTEVRAVNGSKVEQKI
FPEPTIIFVPKHGAHSESDEEKLVRGNLVRKNINRLSLDEIDSLMHALKRMQKDKSSDGF
ESIATFHAIPPMCPNPTAKHRYACCLHGMATFPQWHRLFVVQFEQALQRHGAKVGVPYWD
WTYPMSEIPSFLALEKYVNPYTGIEMFNPFNHGHISYISKETMTHRDISEHIFEKPELGK
QTWLFNNIVLALEQTDYCDFEIQFEVVHNAIHSWLGGKEIYSMNHLHYAAYDPAFYSHHA
NVDRLWVIWQELQKLRGLPAYESNCALEMMSKPLKPFSFGPPYNLNPHTYKYSTPSSVFK
YKEHFHYEYDMLEMNGMSIAQLEAYIRTQKQRERMFAGFLLKGIGQSASATFQVCDEKNS
CHDGSHFAILGGSAEMSWAFDRLYLMEITDILHDMGLKFDSHFHIHHHIKTANGTDLPSD
LIPQATIIRIPALRHEKQRFIPHNRIRQNINSLEERDVQNIMSALTRMKEDESSFGFQTV
ANYHGSTMCPDPENAKYACCQHGMATFPHWHRIYVLQFEEALRRHGSNVAIPYWDWTTPS
DKLPSVLSRSDYYDAWNDVVVENPFLRGYIKSEETYTVRDVQQDLFELAKGGETSLLYDQ
VLLMLEQEDFCDFEVQFEVVHNSIHYLLGGHQKYAMSNLVYSSFDPIFYIHHSMV
Download sequence
Identical sequences Ocbimv22020623m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]