SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22021490m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22021490m.p
Domain Number 1 Region: 196-474
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 8.99e-99
Family Hemocyanin middle domain 0.00000000226
Further Details:      
 
Domain Number 2 Region: 479-579
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 1.7e-36
Family C-terminal domain of mollusc hemocyanin 0.00000827
Further Details:      
 
Domain Number 3 Region: 72-177
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 2.22e-31
Family C-terminal domain of mollusc hemocyanin 0.00022
Further Details:      
 
Domain Number 4 Region: 2-67
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 0.000000000283
Family Hemocyanin middle domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22021490m.p
Sequence length 586
Sequence
MPFDKAYCALDQMSLAMKPFTWESNPNLATRALATPNKLFDYKGLNYKYDNLEFHGMDTE
HLEIEIQKLKQKDRVFATFLLHGIKTSADVHLKLCDDKSCSGAGVVFILGGETEMPWHFD
RTYKMDITKVLKEKGIAMESLFHHDSKVHLEMEIITVDGAVLDQNSLPKPSLVYSPAKGS
VHQHDHHHKEYAEGTIVRKNVNSLTPSEIDNLRHALSDVMADKSENGYQKIAAYHGMPLS
CKYPNGTAYACCQHGMVTFPHWHRLFVKQMEDALKLKGAKTGIPYWDWTTPFTHLPTLVT
EETDNPFHHAHIDSADEITTRAPRHQLFEGRHFFYDQILFALEQTNFCDFEIQFEISHNA
IHSWVGGNSPYSMSTLHYTSYDPLFYLHHSNTDRIWAIWQALQKYRGLPYDSANCEIHRL
KRPLNPFSSDANHNEQTKTHSTGESSFDYHKLHYDYDNLIFHGMTIPQLETELMKSKKKD
RVYAGFLLRTIGQSADVEFEVCRKDGECKFAGTFCILGGEHEMFWAFDRLYKYDITSTLE
QLRLHAHDQFSMKVSIKGTDGSTRASSLIPPPSIMYHPAAGQSSYI
Download sequence
Identical sequences Ocbimv22021490m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]