SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22028330m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22028330m.p
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-20
Family Histidine biosynthesis enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22028330m.p
Sequence length 159
Sequence
GADFIRAEGFVFSHVADEGLVNACAGSLLRYRHQLDADDILVFSDIKKKHSSHSITEDID
IVETAKAAEFFLSDGVILTGTATGSPADQSELEAVKKAVNIPVLVGSGVTCENLVNFVEA
NAIIVGSHFKDAGHWKNDLDIHRVVSFMEKAKKLRSAGN
Download sequence
Identical sequences A0A0L8GTP1
Ocbimv22028330m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]