SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22031096m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22031096m.p
Domain Number 1 Region: 7-312
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 5.07e-99
Family Hemocyanin middle domain 0.0000000988
Further Details:      
 
Domain Number 2 Region: 606-823
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 3.6e-71
Family Hemocyanin middle domain 0.00000000731
Further Details:      
 
Domain Number 3 Region: 432-610
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 5.45e-51
Family Hemocyanin middle domain 0.0000141
Further Details:      
 
Domain Number 4 Region: 827-926
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 1.15e-36
Family C-terminal domain of mollusc hemocyanin 0.00000195
Further Details:      
 
Domain Number 5 Region: 316-415
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 6.93e-29
Family C-terminal domain of mollusc hemocyanin 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22031096m.p
Sequence length 930
Sequence
MAPVDKTGLTVRKDLRSLTTEEEYELRVAMERFMDDKSIDGYQALAEFHGLPAKCPEPDA
IDRVACCIHGMSTFPHWHRLVVMQFEDALIARGSHIGVPYWDWTKPSSELPPLVAAETYE
NLYTKEVRPNPFFHAPVEFLHSDVFTTRSIDARLFEKPTKGHHGYLYDGMMLAFEQEDFC
DFEVQFEVTHNAVHAWVGGNEPYSMSSLHYTSFDPLFWLHHSQVDRLIWATWQALQKFRG
HRYNSANCAIETLRKPMSPFSLTSDINVDSMTREHSVPFDVFDYKKNFHYEYDVLELNGL
SIPKLHREINRRRMKGRVFTTFMLEGIKQSALVEYYIRAHGSTDQVNAGEFYVLGSANEM
PWKFDRVYKADITKQMKEANLHYNDQYHIEYHVKDLAGAEIADVNLEPAIVYEPGLGDFG
VVGVWVEPVTSANRIRKNLNSLTKGDIESLRNAFKDMTLDGRYEEIAAFHGLPAQCPNKD
GSKVYTCCIHGMPTFPHWHRLYVALVENELLNRGSGVAVPYWDWVQPFDHLPALVNEVTY
YNSRTLLIEPNPFFKGKISFLNSETKRDPQPKLFGNKYLYEHTLFVLEQTDFCEFEVHFE
VLHNTIHSLTPSDIKDLRNALAKVQADSSDNGYQKIASYHGMPLSCHYPNGTAYACCQHG
MVTFPHWHRLLVKQMEDALVAHGSHTGIPYWDWTTTFANLPVLVTEKENNPFHHAHIDVA
NKNTTRVALALEQTDFCDFEIQFEIGHNAIHSWVGGSSPYGMSTLHYTSYDPLFYLHHSN
TDRIWSAHSTGKTTFDYHDLGYDYDNLNFHGMTIPELEEHLQEIQHEDRIFAGFLLRTIG
QSADVNFDICTKDGDCAFGGTFCILGGEHEMFWAFDRLFKYDITTSLKQLRLDAHDDFDI
KVTIQGIDGHTLPASYFSPPTVFFSPSKHH
Download sequence
Identical sequences A0A0L8GNM6
Ocbimv22031096m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]