SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22032038m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22032038m.p
Domain Number 1 Region: 47-297
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.31e-65
Family PdxS-like 0.00000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22032038m.p
Sequence length 344
Sequence
MSGQTIATGIITDPDVVVTNLTAVKDETAGRKTGTFKVKAGMAQMAKGGIIMDVTNADEA
CIAEEAGACAVMALERVPADIRRQGGVARMTDPLKIKEIMNAVTIPVMAKARIGHFAEAQ
ILEALGVDMVDESEVLTAADVDNHIDKHKLKVPVVCGARDLGEALRRISEGAAMIRTKGE
AGTGDVSEAVRHARTINREIRTAQAMDSTELYEYAKKLQVPIELLRRTAEMGRLPVVNFA
AGGIATPADVSLLMQLGVDGVFVGSGIFKSSLPEKRARAMAQAVTHYNEPSVLAELSENL
GEAMFGIPHTDRPQDKRREGPIGEEVKIWNATLSNQSYSTKVSS
Download sequence
Identical sequences A0A0L8GKJ0
Ocbimv22032038m.p XP_014780192.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]