SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22036397m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22036397m.p
Domain Number 1 Region: 712-1008
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 3.79e-71
Family Hemocyanin middle domain 0.00000911
Further Details:      
 
Domain Number 2 Region: 289-570
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 6.21e-59
Family Hemocyanin middle domain 0.00000883
Further Details:      
 
Domain Number 3 Region: 152-263
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 7.46e-24
Family C-terminal domain of mollusc hemocyanin 0.00093
Further Details:      
 
Domain Number 4 Region: 591-697
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 3.92e-21
Family C-terminal domain of mollusc hemocyanin 0.00098
Further Details:      
 
Domain Number 5 Region: 7-148
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 0.00000000000000209
Family Hemocyanin middle domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22036397m.p
Sequence length 1045
Sequence
MTFVSHYHTKNFLLEGVLLALEQDDYCRFAIRLEMALIQSFFHTGINPYRLDDMAICHYT
VNADRIFTLWQQLQDYRGRRAAINCALNLLQKPLGSFERVYRNRINLSRINAEPMQLVNP
AVSLGYHYDDLSLNGMNISRLSQLLQERRSKHRSFASFHLRAIKTSAKFRVLVCVPRKGK
TAHVLTDDCNNDAGSFFVLGGDDIHQQKWDYGYPYLFEITDVVESLGVPLDGDYYVHADI
SALNGTQLRDDIIPAPTVSYIPGRRHTNEKKLVKKLRRKFPKKLHKIFPKRKNVNDLTKK
ERLELRLAMMCFVKDKSMQGYQILAEYSGLLKKCPQPESTYQRVCRLHGNPVFLHWNRLA
VKQFENSLSECGTSVALPYWDWTDPVNTIPLFLSNHSFYDPDWKQLRLNPFSRLSVDFMS
YNEEASRNTEWVTEYLGDEKHGALFSQLLLAFEQEDFCDFEIQLEVLQNSFYNIFLVPEF
QTLDHMTFDPLFWMHSNQVDRLWATWQALQFHRGLSSAANCIHSDLHHPLKPFADGPPIN
TNLITFEHSTPDQVHDYRNNLHYEFESLKLGADMSIDIPDLHTRIEDLKKKDRVFIGFLL
RGIKTSAKIQVTVNENFRDNDKRSVPTILASILVYGSPQENEWSFDRYYKHEITHSLLLL
DYKYDDKIPLNVYAEDINGTTLPDAVLPEPVIIYVPNKDNSKWPLQYLPTHERKLVDTLT
SMEEVEIREAMRMFNADKTATGFQRISAMHGSHLWCPYLAAPVKHMCCHHNSKTFLPWHR
LLMMNFDDGLRRYGNRLGAPYWDWTRPFSALPKLATDKVYRDLSGKLRENPFLRTHIDYL
GVDTVRDVQAKLFHPSYRRRVYECVLNALEYMEFERFQSGLEHVHNLIHVLVGGSATYSM
SCLEYAAYDPIFFLHHSMVDRVWAIWQEMYYAFFPDPSYGSTSRYGTEYNETLSPFNITS
VNVYQTTRKYSVPWMTFDYGTNFQYGYDSLTINGKSVAKLSWEIQERQRRDRWFIIAYDL
KDIKQSYIVKFYITLTDTAGKAFNS
Download sequence
Identical sequences A0A0L8I403
Ocbimv22036397m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]