SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22039175m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22039175m.p
Domain Number 1 Region: 175-424
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.83e-53
Family Decarboxylase 0.00000175
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily PRTase-like 8.98e-27
Family Phosphoribosyltransferases (PRTases) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22039175m.p
Sequence length 428
Sequence
MMYECLPDGKKDFARICGVPYTALPLATCIAVNHNIPMLVKRKEAKDYGTKKMVEGNFQQ
NDKCLIIEDVVTTGSSIIETALSLRSLGICVTDAIVLLNREQGCEINLKQYNLNIHSLFT
LKQFLEILCENKKISTETVLNVSQFIAMNQTGYNFLKLKDEETEAKLHQISKRTLNFQQR
AELCSHPVAKRLFTIMAKKQTNLILSVDFTSCAKILEIVEKIAPYICAVKTHIDIVLDFN
MNFISQLVKLSEEFNFILFEDRKFSDIGSTVFHQYTGGVYLISSWAHLVNAHSVPGDGVI
KGLKKSGMADSRACVLIAEMSSAGNLAEGEYTRSTIKMAEEHSDFVIGFICQKKLLSDPK
FIHMTPGVQMSAGKDDLGQQYLTPEKAICVNGSDAIIVGRGIIEDPDPVAAAKIFQAAAY
TAYETQVE
Download sequence
Identical sequences A0A0L8IGN8
Ocbimv22039175m.p XP_014790798.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]