SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22017190m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22017190m.p
Domain Number 1 Region: 141-237
Classification Level Classification E-value
Superfamily TAFH domain-like 1.27e-31
Family TAFH domain-like 0.0000886
Further Details:      
 
Domain Number 2 Region: 423-471
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000001
Family TBP-associated factors, TAFs 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22017190m.p
Sequence length 634
Sequence
NAITLPTSIQLQPGTVLVKNEQGQLVLVHASQSSVLQPQTSTNTTVLPGKLQNVKPMCNQ
GQPRQPTSTPTILTIQQPQGQATTSSHHTVLRQTVPVNHSPVQVSPVTQNSTGSTTTMPS
TIPVGHNQASNVLPNQNSNMIDNVRKCKNFMATLLKLASNQRPETIFNVRELIQGLIDGK
VDPESFTEKLQIELQSSPQPCLVPFLKKSLPLLRHSLYMNKMSIDGVRPPPPEVIRVQTM
CSVPNTTVMTHTKQNVHSHTHNRMTHVTAANRMTTQPQVHGVMSGGHIHQPTQTIIKQVC
PAGQIGHVQVRGGQAKMTTTTVGHPGITVAKSNLGTMTTVGRTNLLNTLPTSTTNLQSHM
QIKKETLAPHKEKRKYESLKDDDDINDVATMGGVNLSEETRNIMATNADFIGTQIRSCKD
ECFLYHSPLLSRISSIAKKYGVEEVPSDVANIVSHATQERLRDFIEKLSTIAEHRTEIYK
MDSRYEVKNDVRAILKHFEELERLEKKRHEEQEREMLLRVAKSRSKHEDPEQLKLKQKAK
ELQLAEMEEMRQREANITALAAIGPRKKRKTEAGDSNQTGTSTSLTNGGVSSSSVRPVVS
RPRIKRVNLRDLLFLMEQDKSLCRSTLMYKSFFK
Download sequence
Identical sequences A0A0L8FKD9
Ocbimv22017190m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]