SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22017980m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22017980m.p
Domain Number 1 Region: 407-794
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-126
Family Ankyrin repeat 0.00000000119
Further Details:      
 
Domain Number 2 Region: 163-421
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-70
Family Ankyrin repeat 0.00000385
Further Details:      
 
Domain Number 3 Region: 8-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.74e-57
Family Ankyrin repeat 0.0000116
Further Details:      
 
Domain Number 4 Region: 1565-1645
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000336
Family DEATH domain, DD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22017980m.p
Sequence length 1928
Sequence
MSDGNSSFLRAARDGNLSEVLEYLKGSTDINTSNSNGLNALHLASKEGHINIVTELLRRG
ANVEAATKKGNTALHIASLAGHEEIVKILVQNGAKVNVQSMTGFTPLYMAAQEGHSEVVK
FLLDNGASQSLATVDGFTPLAVALQQGHDKVVAVLLEHDTKGKVRLPALHIAAKKDDIGS
ANLLLQNDHNADSSTKSGGLVNDTTKSGFTPLHIAAHYGNVNVGTLLIQKGADVNYKAKN
NITPLHVASRWGKSNMVILLLDHDATIEERTRDGLTPLHCAARSGHENVVDLLLERGAPF
SAKTKNGLTPLHMAAQGDHVDCARLLLYHKALVDDVTVDYLTPLHVAAHCGNVKTAKLLL
DRKSDPNARALNGFTPLHIACKKNRIKVVELLLKYDASIEATTESGLTPLHVASFMGHMN
ISIYLIQHNANPDYPTVRGETALHLAARANQTDIIRILLRNGATVDAKAREQQTPLHIAA
RLGNVDNVVLLLQHGASPNATTKDLYTPLHIAAKEGHEEVAAALLDQGADHSLTTKKGFT
PLHIAAKYGNIKVARLLLLKNAEPDVQGKNGLTPLHVATHYNHVNVALLLLDNKASPQAM
AKNGYSPLHIAAKKNQMDIATTLLEFGANPAAGSKNGFTPLHLASQEGHTDMVSLLLEHK
ANVNDKATNGLAPIHLAAQEDKVNVAEVLVKFGSEIDPQTKAGYTPLHTACHFGQTNMVR
FLLDHNASVSSTTKLGYTPLHQAAQQGHVMVINLLLKNKASPNAVTNTGQTALSIAQRLG
YISVVDTLKNLTEVTETLPAIEDKYKVVAPETMTETMLSDSEDEGDDLMPQSPVFGKPLS
EQHVYLPYYEGQTLQMREDTISIEKGDITSPLDLSFDKDLRKVRATSQEARTRDISPGLA
YPKYLEKGPDYEAEMIYYSGDVLSPQEKKGDYFAEDIYARESFRYGREAGPVYRDTMISQ
SVAPRTEAVVYQGELTGSIATDTGSDFRFLPDDSIPKQQDYLEHQIISHTYASHPDNRYL
NNTMESSRYSSYSGSSFNTSFDPDNVAVDRTPTYSGKLKWKSFLVSFMVDARGGAMRGSR
HSGVRIIIPPRKAYMPTRVTCKLIKREKLSHPPPLNEGEALASRILEMGPVGVKFLGPVI
IEVPHFASLRGKEREIAIIRCDDGEKWTEHPILATEEAVNDTLNGSFEGQNSSASSLWKL
DQEDELVAKRITRILTTDFPMYFAIVTRVRQENQTIGFEGGMLSSTVVPQVQTIFPEGAL
TKKIPVGLQAQPIAPELVAKMLGNRVAVSPIVTVAPRRRKFHKPITLTIPVPRAAQKGMI
NQYGGEAPTLRLLCSISGGTTPAVWEDITASTQLTFVNDCVSFTTTVSARFWLMDCQNVN
EASRMATELYQEAVVVPFMAKFVIFAKRHAPEEGKLRMFCMTDDKIDKTLEKQEKFTEVA
RSRDVEVLQGRPQYVEMAGNLIPVTKSGDQLYVHFRAFRENRLPCTVKVRDLDQEAAARV
AFMKEPKVARGEAPQSPICNLNIVLPDVSKADSTEITSEEALEVRKRHSLLREHGIVLQD
TISRAQMKIVDVADTLQGDWVMLAQQLDITMSEINKIKTDYNTVNDQALAMLHLWVEKNG
EKASGNALEKALIRINREDVVKKCMYDVVTVEDEVDMAAGRVAMDQSGFDTFKEEVGISR
DSSMKRGISLDVSYDEQDMIKMKKSPEIKSLHSKILESESAEESGSDADTERHRIAKAPP
PPAAMSQDEVLVKHVDHRRPEAAPVAESSVDDTDRKKNAFVEFARQMDELSDMEETIKPV
ATSEQDEKPSITEETIVSRVKGAGTVTSVITKTVVTETVAKEAIVKDEAPEVMAPCVDVA
DSRSSSGSSICDKEQQEILPQTKTPPPSPTETSTSELVSHRTTELAQARDRLSEEMESNQ
HTPSATGV
Download sequence
Identical sequences A0A0L8HC69
Ocbimv22017980m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]