SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22024233m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22024233m.p
Domain Number 1 Region: 556-888
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.26e-53
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0049
Further Details:      
 
Domain Number 2 Region: 227-546
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.66e-45
Family Lipovitellin-phosvitin complex, superhelical domain 0.00036
Further Details:      
 
Domain Number 3 Region: 23-219
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.3e-28
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0018
Further Details:      
 
Domain Number 4 Region: 3225-3358
Classification Level Classification E-value
Superfamily vWA-like 0.000000473
Family Integrin A (or I) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22024233m.p
Sequence length 3479
Sequence
MSMSEIALNYKENLLEEVNIDETLFQQAVHFSFHNGEIKTLWEPDPDPKSHSNPLDMEQV
MNIKKGVLSLFQNSLDSFHRSKSLIETDVLGKCLTHYEVDPFSNSLSYLVTKKKDLDSCE
GRQHYINTVHSVNYGDDTVDTQPSLTKISYMCKQSFSKKTNTLTSVTCTERHVFCPFSHD
LNGAYSSQVQTLQYMFTRKIDIARFPDRSTRVTKLLFQYHTGHPNIDNKDIRNILGTLQI
LCLKYSEDVRPEFPEILEGLVSAMRQVDVSGLMKIHEIISSQKFCAEKTNHVRQYFLDAI
PMVQTLESVKFIVQMISSQQIGETDAMLWLTAISLIFQPSKEMVAACIPLLRMKDVPQNM
ALALSSLIWNYCRTIGDACQQDPTVDTFLQQQEALIVGNGDGADTACTYHPGEKTTDVLM
ALRAIGNLGYFQKILAHVARCFTRRENPSEIRVAALEAMRRTRCGTTIPGLNEVFFDDTE
DSELRIQAYIILMRCPSRKFLLAVHNILLKGKSNQVGSYIWSHLNNLAETADPYLQEIRT
ILEDVMLKKEFDLDGRKFSHYYEKFLYSTTLDVGAKLDSNVIFSSKSFIPRSTNLNITVH
LFGRAVNFLEVGGRAQAVDQILENFFGPMGFFSDPLTSTTKTIKLSEDQKNMKSKPIDRE
KFLVSFYIRVFGNEIHYSNDFSFDKASKLLEYLLTPEHFKVTRSFSLLDTETVLPTCSGL
PLHLKITSTGSFGLHGSKFLQLPSFSAALKPSVSLRMTGQMSVKAFKFRAGVQITGTAHS
SVGARVEMNNEELTVDLTKKKMEIFSFRSDMYLIHGARTKLLTADMEIDDNNINSKKKNK
ICSSEQVLAITGLRLCQEVNIPSVFLLKRGPFIPLTGPLVYDLHLIKEDMPEGVLITIIP
FDDRNMLTVDTPESKQQRTVFIMATTKEEYLTVDVVSPWRDINMKVVPIKNQKSQTTGAR
ILLKDDDKLYTASVWTKTQQWVNGSLSMTQLDVTRPDHTWSVKSVITQIPGKNVQINVSS
EGFKTRNMVLTLSKSIVIDATSIMGTLKIGPDIYTLQGGLDQPWKKIGFKYVSYLKVTDP
HKTVLDFSAGISNEPGKRFLVDVKLDKVYSKLVSFYGLITFNAVSKQSKNLLRISVRSPL
GILRLNGDNQIQNLETHNQMIFYYNFGPEYIDRLKIVTDTKKKALTNSSFYSWRMQFSSK
KNAALALTTQGQLIISLSDGWQIEVKTKYGVPKDNHFINFQSLYNCTATNSTRTMRYSVS
LHTASKQLEFTADTSYISGSFSFSRKFRNSLTVTTAQGNVLNTSLSFVDKETKYFRSLAF
AVLFSTHNQEILFLEELTQQKTVPTKLTNHLQVQWQKGQRLTIYTTFQNYSSIVYQMNNE
IHTFSGRTANFSSTFLNTKDHYKASLQLNADSGLFLKKKISYFGESSLRYKINPEGSSWE
LVVNQTESTNQNLLFVAVFSKQLFQLIFRNSNDPYNKTNFDITGKHFWLNGKYHSMWSFT
STFRRMEQNLTFDPDGIELRYAASSSLVLYKNDLSSFVLNFTSPKTQNNSVNKLTAELRG
VHTADVLVEFTKTDNGYDSKGRLNFNVLDSTGHARVDLSYSDSNRLTSSGIFYWHPPIHK
TNIMNHALLATLMRNSSFKIVYNKKGGIHTGSSYMEISGVKPIIIKTSLYITDAKDIANI
SLRAENGNNPYLSEVALNFYYKINDRSLTSMGFLKILPYFNTSYLEISLVKGRVSEAVIK
MKTPYESLRSLQLMVSFETDFRVSKMIRSNLKHNENELIGLTLNQYFLSNNDFGLTLFTQ
VYNRRHEPISLNLKYTFKYDDLLLNFAFNMAPRISFSCSLKKWSTKQFQYFLKVGLDDEV
YKAGISISDKFINSKTVDISLTTSNIKVVIFWLFNNDNKEVSRVTYQIAYDGIFFVLSGS
YLNQLDEEKVNIHMKIHHLIYRLFIINSREPGKSKKLDFKIQNHSPINSEMKICNFGEWS
SIHIVLNFNIDLKDQQNISAMFSINSTCTQHFIVLYEFSELNEYENRKSVYITCPDHGLS
GIVVVDSSYIPVLKYDIHLSLDTRPHKKGMEPLREHYHRSDNLVDNIKEQSSETNILFVT
AEWISNQKISVKADLTKQKQSVYFHQNSTATTLFLYFDDININTTNNKAKRSSLISGQKS
SDRFAVSLKNAYLKLIQIHLPYKSSLFVWIKIPQASPRAMTLPQDISSHDLNKLTKMLIG
EMHLDFGAVLKIMLKFTTPSRTIQASGTFENKQRDPQSFDVIVIYNAGASKSKKFLLKLN
GENGSKMKRLGISVLFPQSKNEVKLKVKLSGRERKILMSGKAVFTLSRENDGPMTLVFHS
KLFETNGKYKLTVLSENLYTDMFVRLESFITLAPGIYDLELYSSHVTQQKEITRSKNLKM
YWSEKKFHFQILSPKKEISLTASVDTEGTYQIVVRRLKKELLQENFLMEGTFDTATCSFN
MKLMHDPDNVTNIYNMMINFTKSGVLFMDNINTGPFSSSSSNKALFELRPGDILYGEMIW
KPNFIRDISNYFSQALKTCHKEFQSTGQQNIQNIAMSFWDIVKPINQAILTEVKPLVPYI
KTEFENAHHEYSIYSKILVDHYNNNYLYVKSFHKAMWKIYDYLKGSQLLQYQSQVWFEMV
KIWEICQQIFQYLYDQYKITSTYMSKTLTHHLHRSHTHYIELVMAAVNYLKQNFFINDIT
HYIKHEFGPKLTNFFMDAFEFVFENGIQIMQYVTDRLVSVLAQARDYFQPYIQLPIINAL
LDIIKEIYYEMIAACSDISLKESIHKSVSTKLSSMRDTLTNFSITPNIIIQKWGHIVFEV
NYYVFTIPSNIVQFGRDFSSQVRERATGIYKRARYLLGSELTFWDLYYEMKPSTDVANWF
PPFKAHAILFGSQHVITFDRLHYEIKARCSVVLSRDVVNGTFAVIANYQFDSPDRQPFSV
TVVTEYDEHVEILQNQKVKVGGTEVNLPMTLTRGIVFRTQEAVTLESSRGYQVTLNFEAN
LLEVEISGWYFNKVAGLFGTYNNEPHDDFNLVSQEEMEMELKSGPGADLDSSGNLEMFAK
SWTVSENCKSLLPLQINQNMIMTPDNKYDMNINDGDGDDDVDDNWNSDGCARLFLQKSSQ
FRNCFKQVTPGYFYKMCSSDVPIDALTTPSAAAKPSKDNLCAVSSLYIRECQRQGVPLTM
PMECLFCLTINETKVQQGEVMSLNPVSTPYLADIIIVLQETKCNSETGSKLPQIIENLNF
LLSLINFSNTKFGLVGFGGNYTTPVYLHTFDGQTMSDSLMVSDVLYDINYENNRQQQPLD
IMQALTRALHYPFRTGAMKAVILVTCSSCQDNNVVSFELREALREQDVILHVLAEQNFKS
VGNINPEKAHIYGANHRNIYPIDSNNFANISGHQIVPDDSCAQEAIHSKGSYFNTKKLNK
VTTSRSFMQTFCAYIALSLKHNFCQNCQCVPRQEGYRGHFLCHRCPQLPPNIVEEINIT
Download sequence
Identical sequences A0A0L8H349
Ocbimv22024233m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]