SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15612894|ref|NP_241197.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15612894|ref|NP_241197.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily AF1862-like 6.41e-25
Family Cas Cmr5-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15612894|ref|NP_241197.1|
Sequence length 125
Comment hypothetical protein BH0331 [Bacillus halodurans C-125]
Sequence
MKSLDAHYANIALQSIQELEKSDEAFKTSFGSLCHQFPSMVRLNGLRLTVAFYESKKENT
AHARYLAGLKAALGVSISANDIPERGAEYRRMTEQALRASIWFKRYAEAILKCSPTSEPV
REGDV
Download sequence
Identical sequences Q7AJZ5 Q9RC62
272558.BH0331 WP_010896512.1.28103 gi|15612894|ref|NP_241197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]