SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15612908|ref|NP_241211.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15612908|ref|NP_241211.1|
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.65e-16
Family SinR domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15612908|ref|NP_241211.1|
Sequence length 116
Comment transcriptional regulator [Bacillus halodurans C-125]
Sequence
MAELKDRLRELRNAHNLTQQEVASFLNITESAYGFYEQGRNEPSIGKLKQLAQKYNVSIA
FLAGETDAKEPYANSSVHEHPLSYKYKDLDDEELRFLDEQLELFRRLKREKEEKSQ
Download sequence
Identical sequences Q9KFX5
WP_010896525.1.28103 gi|15612908|ref|NP_241211.1| 272558.BH0345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]