SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15612964|ref|NP_241267.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15612964|ref|NP_241267.1|
Domain Number 1 Region: 143-299
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.45e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0025
Further Details:      
 
Domain Number 2 Region: 59-110
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000166
Family AraC type transcriptional activator 0.009
Further Details:      
 
Domain Number 3 Region: 7-57
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000672
Family AraC type transcriptional activator 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15612964|ref|NP_241267.1|
Sequence length 299
Comment hypothetical protein BH0401 [Bacillus halodurans C-125]
Sequence
MSMSDRARFHAVFQYIETHYKDRIDLDTLANRSHLSKYHFSRLFKELTGDSPMAYVNKVR
VQKAIPLLTSTKKTVLEIASLCGFDSVSTFNATFKKHYDLTPSYVRKNSNNSLVVSKKQE
ELPAVLRYDPINEDSFLRRIWTMNISIKELPDYEVAFVRHVGSYLETYKAWATLGAWASE
NRLDPPQSYFIGISLDDPKEVEEHLCRYDACVTLPEGFTKKPHEDIQFKGLSGGTYALYS
FYDRVDKLGIVYQSIFTQWLPASGFVADDKPSLEFCMNDPALDPEGKAKVDLYIPIRKK
Download sequence
Identical sequences Q9KFS6
272558.BH0401 WP_010896579.1.28103 gi|15612964|ref|NP_241267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]