SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15613173|ref|NP_241476.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15613173|ref|NP_241476.1|
Domain Number 1 Region: 146-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-60
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000047
Further Details:      
 
Domain Number 2 Region: 430-562
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.98e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000532
Further Details:      
 
Domain Number 3 Region: 12-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-34
Family Duplicated SiR/NiR-like domains 1 and 3 0.0016
Further Details:      
 
Domain Number 4 Region: 347-423
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.78e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15613173|ref|NP_241476.1|
Sequence length 572
Comment sulfite reductase subunit beta [Bacillus halodurans C-125]
Sequence
MGNERLKAPEGPPSDVERIKEESNYLRGTLKESMLEPISAGISDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVATPEQWLVMDELAQKYGNGTMKLTTRETFQLH
GILKWNMKKTIQAIHSALLDTIAACGDVNRNVMCTSNPYQSEIHQEVYEWSKKLSDDLLP
RTRAYHEIWLDEEKVAGTPEAEEVEPMYGPLYLPRKFKIGIAVPPSNDIDVFSQDLGFIA
IVEDDKLVGFNVAIGGGMGMTHGDKATYPQLAKVIGFCKPEQIYDVAEKIITIQRDYGNR
SVRKNARFKYTVDRLGLETVKNELENRLGWSLDEAKPYHFDHNGDRYGWVKGVKGRWHFT
LFVEGGRVTDYADYKLMTGLREIAKIHTGDIRLTSNQNLIIANVTSQKKKKINELIEQYG
LTDGKHYTALRRSSIACVALPTCGLAMAEAERYLPKLIDKIDEIIEENGLKNEEITIRMT
GCPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILKELREILPR
YAKERKEGEHFGDFVIRAGIIKETTDGTNFHD
Download sequence
Identical sequences Q9KF75
WP_010896787.1.28103 272558.BH0610 gi|15613173|ref|NP_241476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]