SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15613176|ref|NP_241479.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15613176|ref|NP_241479.1|
Domain Number 1 Region: 625-789
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.45e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 2-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.26e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00083
Further Details:      
 
Domain Number 3 Region: 515-633
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.71e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15613176|ref|NP_241479.1|
Sequence length 807
Comment assimilatory nitrite reductase subunit [Bacillus halodurans C-125]
Sequence
MKEKLVVVGNGMAGIRTVEELFERGGHERYEVTVVGEEPHVNYNRILLSSVLASEANMED
IELNSLDWYRENDVTLYRSEKVTKLDRKKKVVLTDKGQKIAYDKVILATGSHPFMLPLPG
SDLEGVIAFRNIEDCETMIETAKNYKKAVVIGGGLLGIEAARGLLNLGMEVEVVHIFDYL
MERQLDRTAANILRTELENQGMKFLLEKHTEAIIGKGRVERVKFKDGTETRADLVVMAVG
IRPNHEVASASGIEVNRGIVVDDYMQTSDPDVYAVGECAEHRGMVYGLVAPLWEQGKILA
NALMDNKDEKYEGSVLYSKLKVSGVQVFSVGEFQEQDDAKSVSMLDEFAGIYKKIVTRGD
KIVGSILVGDTSESTILLNQIIKGVPFEGSPMQLLRSHVGSADDGVSAVSMLSNEDQVCG
CNGVSKGAIIDAIKTQGCASVADVGACTTAGRSCGTCKPMIADLLAEELGETANEKETMC
GCTDLSHEEVVAAIREKGLTHTREVMNVLGWKEEHGCSKCRPAINYYLAMVHPLEHEDER
ESRFVNERLHANIQKDGTYSVVPRMYGGVTNPDELRRIADVAEKFNVPLLKITGGQRIDL
LGVKKEDVPSVWKELDMPSGYAYGKALRTVKTCVGEDFCRFGTQDSIGLGIAIEKKFERL
NTPHKVKMAVSACPRNCAESGIKDVGIVGVEGAWEIYVGGNGGASLRLGDLMCRVKTSEE
VLEIIGAFLQLYREEARYLERTSHWVERVGLDYIKETLLEHPENRKVLNERMDEALSVLT
DPWEEINNDPSLKETLFEEKVAVVTSE
Download sequence
Identical sequences Q9KF73
272558.BH0613 WP_010896789.1.28103 gi|15613176|ref|NP_241479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]