SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614007|ref|NP_242310.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614007|ref|NP_242310.1|
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000059
Family SinR domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15614007|ref|NP_242310.1|
Sequence length 72
Comment hypothetical protein BH1444 [Bacillus halodurans C-125]
Sequence
MSLLRKTRKKKGYSLEEASQKLGISAGYLSQIELGQRQVSRERAMQIAALYGLSHEDLFY
PTRFARKMERKD
Download sequence
Identical sequences A0A0M0KL60 Q9KCX5
WP_010897609.1.28103 WP_010897609.1.91347 272558.BH1444 gi|15614007|ref|NP_242310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]