SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614377|ref|NP_242680.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614377|ref|NP_242680.1|
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000873
Family Phage repressors 0.069
Further Details:      
 
Domain Number 2 Region: 153-283
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000228
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Domain Number 3 Region: 88-185
Classification Level Classification E-value
Superfamily TPR-like 0.0000101
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15614377|ref|NP_242680.1|
Sequence length 297
Comment hypothetical protein BH1814 [Bacillus halodurans C-125]
Sequence
METLSVGHKIKTLRQSLGLSQRDLAEGICTQALISHIEKNKTTPTVDVFFNIAKKLGAPA
DYFLETHDNSLDYILEVQYQIRKQVQEHNYEEALNIIKTERKNPIFNNSKYLQFLLWHEA
ICEYSLNKRYNEAVEAIEEALKLTHKEGNSYSEREIEILISLANFHDSEKKYDLSTKIYQ
DINDSLKALSYLSDRKIQLRFLFNYSLNRNNVKRYKEAIDLCNKGIILCKQHGFLYSFGE
FHYQKGQNLIDLGRKKEALKFLEKAKMIFDIQDNELFANIADKEIKKLQKSLEMTVS
Download sequence
Identical sequences Q9KBW0
WP_010897975.1.28103 gi|15614377|ref|NP_242680.1| 383035 BhR202 272558.BH1814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]