SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614418|ref|NP_242721.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614418|ref|NP_242721.1|
Domain Number 1 Region: 57-317
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.04e-65
Family L-arabinose binding protein-like 0.0000247
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.91e-16
Family GalR/LacI-like bacterial regulator 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15614418|ref|NP_242721.1|
Sequence length 326
Comment transcriptional regulator [Bacillus halodurans C-125]
Sequence
MTTILDIAKLAGVAKSTVSRYLNGGSVSEPTRQKIERVIKETGYIPNAFAQSLKAKQTNF
IGTIVPRLDSFAASRTVMGIDDELKSLGYQMLMSNTDQSVEREIETIYNLANQKIAGVIL
LATVITKEHLNAFREVGIPTLLVGQEHTEVPCLIHDDFKAGYEMGKHVLSKGHKRIAYLG
VGEHDIAVGVKRKEGFKQAMAEHGPCEVAYFETSFSMQDSFRVSPKMIETYQPSALVCAT
DNIALGALKGAYSIGMNVPKDLSITGFGGYEVTGIIHPSLTTVNFHFKAAGKMAARKMIK
LMNGEEVNHLTRMDVELIERESVDNV
Download sequence
Identical sequences Q9KBS0
WP_010898016.1.28103 gi|15614418|ref|NP_242721.1| NYSGXRC-11019f 272558.BH1855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]