SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614438|ref|NP_242741.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614438|ref|NP_242741.1|
Domain Number 1 Region: 84-367
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.52e-62
Family L-arabinose binding protein-like 0.0000783
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.87e-19
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15614438|ref|NP_242741.1|
Sequence length 375
Comment arabinose operon transcriptional repressor [Bacillus halodurans C-125]
Sequence
METKYNFVKQQIKSKILEGIVLPHGKIGSENELMKEYNVSRHTVRKAIDELVNEGWVYRK
QGAGTFCADRTDQKNPIGKAQRKNIALITTYLSEYIFPSIIRGAESILSEHGYQVTIFST
NNNHEQEKRALEAVLSQRFDGLIVEPTKSSIPNPNINYYLNLERQGIPYVMINAYYEELE
PYFLGMDDVKGGYTQTKHLLDLGHEQIVGLFKNDDLQGAKRLKGFIKAHRERGIALNPQH
IITYTTEQKNAKPLEELHRIFKDRSHRPTGIVCYNDELALKLLDVIREFDIRVPEELSVV
GYDDSFLSVASEVKLTTIQHPKVEMGIDAAKLIISCIEQERKDRSADGEQSIIYEPKLVV
RHSTAEAKSEKGVAK
Download sequence
Identical sequences Q9KBQ0
272558.BH1875 gi|15614438|ref|NP_242741.1| WP_010898036.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]