SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614688|ref|NP_242991.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614688|ref|NP_242991.1|
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.58e-17
Family SinR domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 75-109
Classification Level Classification E-value
Superfamily SinR repressor dimerisation domain-like 0.0000000000000615
Family SinR repressor dimerisation domain-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15614688|ref|NP_242991.1|
Sequence length 112
Comment post-exponential-phase responses transcriptional regulator [Bacillus halodurans C-125]
Sequence
MMIGERVKKYRLEKELSLSELAERAGVAKSYLSSIERNIQTNPSIHFLEKISQVLDVSVE
SLLQSTQDTTSREELDEDWKKLVKEAMESGISKDQFKEYLEFQKWKSQQSER
Download sequence
Identical sequences Q9KB11
272558.BH2125 gi|15614688|ref|NP_242991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]